Property Summary

NCBI Gene PubMed Count 128
PubMed Score 60.12
PubTator Score 387.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
nephrosclerosis 1.563 9.2e-04
Waldenstrons macroglobulinemia 1.356 6.4e-03
Multiple myeloma 1.427 2.6e-03
malignant mesothelioma -2.500 4.6e-07
cutaneous lupus erythematosus 1.100 1.8e-02
osteosarcoma 2.623 2.7e-06
cystic fibrosis 1.964 7.3e-06
tuberculosis 1.400 2.8e-05
non-small cell lung cancer -1.838 8.0e-22
intraductal papillary-mucinous adenoma (... -1.900 7.9e-03
intraductal papillary-mucinous carcinoma... -2.600 4.3e-04
intraductal papillary-mucinous neoplasm ... -2.300 7.7e-03
lung cancer -3.300 1.3e-06
interstitial cystitis 1.700 4.5e-04
lung adenocarcinoma -1.900 1.1e-10
pilocytic astrocytoma 1.500 1.4e-06
primary Sjogren syndrome 2.200 5.7e-05
lung carcinoma -2.100 1.3e-25
ulcerative colitis 2.500 2.3e-05
ovarian cancer -1.700 1.0e-04

Gene RIF (94)

PMID Text
27052461 Concurrent exogenous expression of three transcription factors, GATA1, FLI1 and TAL1, enables large-scale production of megakaryocytes from human pluripotent stem cells.
26336820 Identify SP1 and PI3K/AKT signaling as modulators of EWS/FLI1 gene expression in tumor cell lines.
26316623 Mutation in FLI1 is associated with Paris-Trousseau thrombocytopenia.
26305602 Fli-1 expression gradually increases in parallel with disease progression.
26261664 Case Report: SMARCB1-deficient vulvar sarcoma expressing ERG and FLI1.
26159733 erythrocyte lineage enforces exclusivity through upregulation of EKLF and its lineage-specific cytokine receptor (EpoR) while inhibiting both FLI-1 and the receptor TpoR (also known as MPL) for the opposing megakaryocyte lineage
26156017 This study for the first time identifies FLI1 as a clinically and functionally important target gene of metastasis, providing a rationale for developing FLI1 inhibitors in the treatment of breast cancer.
26063314 Overexpression of FLI1 and ERG genes is sufficient to transdifferentiate erythroblasts to megakaryocytes that can produce functional platelets.
26055516 Fli1 is epigenetically suppressed and is a potential predisposing factor in the pathogenesis of systemic sclerosis. (Review)
25779942 SLFN11 has a role as a transcriptional target of EWS-FLI1 and is a determinant of drug response in Ewing sarcoma
25712098 Data suggest that aberrant cell cycle activation in Ewing sarcoma is due to the de-repression of transcription factor E2F targets of transcriptional induction and physical recruitment of E2F3 by fusion protein EWS-FLI1 replacing E2F4 on their promoters.
25504335 Simultaneous downregulation of KLF5 and Fli1 is a key feature underlying systemic sclerosis.
25483190 The similarity among the phenotypes of EWS/FLI1- and EWS siRNA-transfected HeLa cells points to the inhibition of EWS as the key mechanism for the induction of midzone defects.
25472652 FLI1 promoter hypermethylation is associated with Colorectal Cancer.
25453903 EWS-FLI1 establishes an oncogenic regulatory program governing both tumor survival and differentiation.
25421497 endothelial CCN1 downregulation at least partially due to Fli1 deficiency may contribute to the development of digital ulcers in systemic sclerosis patients
25379017 FLI1 levels are reduced in human breast cancer samples and cell lines.FLI1 expression is correlated with breast cancer cellular growth, migration, and invasion and altered gene expression.
25062258 p16 and possibly Fli-1 may have utility in the assignment of growth phase for cutaneous melanomas.
25057021 EWS/FLI-induced repression of alpha5 integrin and zyxin expression promotes tumor progression by supporting anchorage-independent cell growth.
24923303 Results show that overexpression is intimately related to malignant phenotypes and poor clinical outcome of epithelial ovarian cancer.
24735198 Case Report: primary subcutaneous Ewing sarcoma in a 16-year-old female composed entirely of spindle cells exhibiting strong, diffuse immunohistochemical reactivity for S100 and EWSR1-FLI1 fusion.
24708674 bosentan...increased DNA binding of Fli1 and the suppression of type I collagen expression in systemic sclerosis fibroblasts
24375017 Demonstrate an important role for Flii in the development and regulation of the epidermal barrier, which may contribute to the impaired healing and skin fragility of epidermolysis bullosa patients.
24292093 Fli1 bound to the CXCL5 promoter and its gene silencing significantly suppressed the CXCL5 mRNA expression in human dermal microvascular endothelial cells
24124617 we detected the Ewing sarcoma-specific EWS/Fli-1 mRNA in MVs from the culture medium of Ewing sarcoma cell lines. Also, we detected this fusion gene in approximately 40% of the blood samples from mice inoculated with xenografts of TC135 or A673 cells.
24100448 alterations in FLI1 and RUNX1 may be common in patients with platelet dense granule secretion defects and mild thrombocytopenia.
24072183 Report FLI1 expression in epithelioid sarcomas.
24058639 these results indicate that under quiescent conditions Fli1 recruits HDAC1/p300 to the COL1A2 promoter and suppresses the expression of the COL1A2 gene by chromatin remodeling through histone deacetylation.
24055811 FLII is a component of the ChREBP transcriptional complex and negatively regulates ChREBP function in cancer cells.
23940108 Results show that EWSR1/FLI1 binding independent of E2F3 is predominantly associated with repressed differentiation genes. Thus, EWSR1/FLI1 appears to promote oncogenesis by simultaneously promoting cell proliferation and perturbing differentiation.
23926301 these data identify the 11q24.3 gain as a recurrent lesion in diffuse large B-cell lymphoma leading to ETS1 and FLI1 deregulated expression, which can contribute to the pathogenesis of this disease
23774214 Overexpression of the ETS-related transcription factor ETV1 can initiate neoplastic transformation of the prostate.
23667468 a novel function for Fli-1 in T cell development and leukaemogenesis
23663495 Fli1 and CTGF are important mediators of the fibrogenic actions of adenosine
23518636 Podoplanin and Fli-1 immunohistochemistry may be useful in distinguishing atypical fibroxanthoma from angiosarcoma.
23441188 Genomic EWS-FLI1 fusion sequences in Ewing sarcoma resemble breakpoint characteristics of immature lymphoid malignancies.
23327922 Transcriptional regulators cooperate to establish or maintain primitive stem cell-like signatures in leukemic cells.
23178492 The results demonstrate that a previously less-well characterized transcriptional repressive function of the EWS/FLI fusion is also required for the transformed phenotype of Ewing sarcoma.
23165331 these results fill a gap in the literature: the confirmation that MCC is devoid of the EWS/FLI-1 rearrangement.
23145994 Data suggest that the junction region can be exploited further as target for drug development in future to specifically target EWS-FLI1 in Ewing's Sarcoma.
23041765 Ciprofloxacin has antifibrotic actions in Systemic sclerosis dermal and lung fibroblasts via the downregulation of Dnmt1, the upregulation of Fli1.
22965552 In 5q- syndrome, but not Diamond-Blackfan anemia, blood & bone marrow mononuclear cells had high Fli1 mRNA levels. This protects megakaryocytic cells from ribosomal stress & permits effective though dysplastic megakaryopoiesis.
22930730 We found that transcriptional activation of PRKCB was directly regulated by the chimeric fusion oncogene EWSR1-FLI1 that drivesewing sarcoma growth.
22887642 Our findings of SNP array adn phenotype correclation do not support the traditional view that FLI1 deletion is the cause of thrombocytopenia in Jacobsen syndrome.
22372906 Data show there are no differences in the distribution of immunohistochemical reactivity for CD31, CD34, D2-40, or FLI1 between AIDS-related and non-AIDS-related Kaposi sarcoma (KS) or between nodular- and patch/plaque-stage KS.
22086061 EWS-FLI chimera acquired chromatin-altering activity, leading to mistargeting, chromatin disruption, and ultimately, transcriptional dysregulation.
22081504 FLI1 is a novel ETS transcription factor involved in gene fusions in prostate cancer and that intratumor genetic heterogeneity of ETS rearrangements can occasionally be found in index primary tumors.
21931859 Expression of FLI-1, ELF-1, and GABP activated the PF4 promoter in HepG2 cells.
21917756 FLI1 expression is frequently abnormal and prognostically adverse in acute myeloid leukemia.
21643012 a novel oncogenic mechanism in Ewing sarcoma, involving post-transcriptional derepression of IGF signaling by the EWS/Fli1 fusion oncoprotein via miRs
21633373 we have demonstrated association between FLI1 and susceptibility to CL caused by L. braziliensis.
21571218 The genome-wide binding sites for the FLI1 in primary human megakaryocytes to identify the essential regulator of complex mammalian differentiation processes.
21451544 a role of Fli1 as a negative regulator of the estrogen receptor alpha gene in dermal fibroblasts.
21321929 these results demonstrate that in SSc fibroblasts, c-Abl is an upstream regulator of the profibrotic PKCdelta/phospho-Fli-1 pathway, via induction of PKCdelta nuclear localization.
21087477 study demonstrates that a GA(n) microsatellite in the human Fli1 promoter is highly polymorphic
20933505 these results suggest that suppression of FOXO1 function by EWS-Fli1 fusion protein may contribute to cellular transformation in Ewing's family tumors.
20879862 The rapid downregulation of FLI-1 expression after LPS stimulation attenuates the induction of various MMPs and IL-10 under inflammatory conditions.
20676125 a self-sustaining triad of LMO2/ERG/FLI1 stabilizes the expression of important mediators of the leukaemic phenotype such as
20665663 These results demonstrate that EWS-FLI blocks the ability of Runx2 to induce osteoblast specification of a mesenchymal progenitor cell.
20382729 EWS-FLI-1 and miRNA-145 function in a mutually repressive feedback loop and identify their common target gene, SOX2, in addition to miRNA145 itself, as key players in Ewing sarcoma family tumors cell differentiation and tumorigenicity
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20308673 Propsectively evaluated the impact of EWS-FLI1/ERG fusions on disease progression in Ewing's sarcoma/peripheral primitive neuroectodermal tumor.
20308669 Intensive treatment protocols for localized Ewing family sarcoma have erased the clinical differences observed in patients with EWS-FLI1/ERG fusions.
20228226 persistently reduced levels of Fli1 in endothelial cells may play a critical role in the development of SSc vasculopathy
20103643 Findings suggest that EWS/FLI1 induces apoptosis, at least partially, through the activation of CASP3.
20019092 EWS/FLI1 inhibits both DKK-1 expression as well as beta-catenin/TCF-dependent transcription, which could contribute to progression of tumours of the Ewing family.
19859563 GLI1 is a central mediator of EWS/FLI1 signaling in Ewing tumors
19417137 Interaction between EWSR1/FLI1 and EWSR1 in Ewing sarcoma may induce mitotic defects leading to genomic instability and subsequent malignant transformation.
19349856 report FLI-1 expression in an expanded series of 75 cases of T-cell lymphoma and found high expression in anaplastic large cell lymphoma and angioimmunoblastic T-cell lymphoma
19158279 The phosphorylation-acetylation cascade triggered by PKC delta represents the primary mechanism whereby TGF-beta regulates the transcriptional activity of Fli1 in the context of the collagen promoter.
18785112 Expression of Fli-1 in malignant melanoma appears to be associated with biologically more aggressive tumors.
18648544 IGF1 is a common target gene of Ewing's sarcoma fusion proteins EWS-FLI-1, EWS-ERG and FUS-ERG in mesenchymal progenitor cells
18414662 EWS/FLI mediates transcriptional repression via NKX2.2 during oncogenic transformation in Ewing's sarcoma
18174230 Observational study of gene-disease association. (HuGE Navigator)
17884818 PCAF-dependent acetylation of lysine 380 abrogates repressor function of Fli1 with respect to collagen expression; TGFb-dependent acetylation of Fli1 may represent the principal mechanism for TGFb-induced dissociation of Fli1 from the collagen promoter
17727680 results suggest that Fli-1 contributes to the malignancy of human breast cancer by inhibiting apoptosis through upregulated expression of the bcl-2 gene.
17163154 variation in overall gene expression patterns downstream of EWS-FLIl was observed, but also differential regulation of directly EWS-FLI1-bound genes
16964281 EWS/Fli-1 and Fli-1 increase PLD2 gene expression by binding to an erythroblast transformation-specific domain of PLD2 promoter
16930139 Fli-1 is rather constitutively expressed by bone marrow cells in Ph(-) CMPD independent of the underlying JAK2 status
16829517 Fli1 and Ets1 have roles in the pathological extracellular matrix regulation during fibrosis and cancer
16802366 The signal transduction leading to the systemic sclerosis (SSc) fibrotic phenotype appears to converge on DNA methylation and histone deacetylation at the FLI1 gene.
16148010 the repressive properties of PIASxalpha/ARIP3 require its physical interaction with FLI-1, identifying PIASxalpha as a novel corepressor of FLI-1
15919668 EWS-Fli1 may play a role in the regulation of PDGF-induced tumor proliferation-signaling enzymes via PLD2 expression in Ewing sarcoma cells
15809330 Protein phosphatase 2A controls FLI-1 phosphorylation. Newly synthesized FLI-1 decreased during human T cell activation. Although the FLI-1 & ERG genes are highly homologous, their distinct properties may contribute to different roles in gene regulation.
15798196 Two functional NLSs were shown to exist in Fli-1; each NLS is sufficient to target Fli-1 to the nucleus for activation of megakaryocyte-specific promoters.
15282325 These findings identify the repression of insulin-like growth factor binding protein 3 gene by EWS/FLI-1 as a key event in the development of Ewing's sarcoma.
15273724 Ability of Ewing Sarcoma-Fli-1/Fli-1 to target transcriptional cofactor(s) and modulate apoptotic pathways may be responsible for its antiapoptotic and tumorigenic activities.
15232614 Overoverexpression of FLI1 in patient CD34(+) cells restores the megakaryopoiesis in vitro, indicating that FLI1 hemizygous deletion contributes to Paris-Troudeau syndrome hematopoietic defects.
15021903 oncogenic rearrangement of EWS to produce EWS/Fli-1 may enhance the antiapoptotic effect of Brn-3a and inhibit its ability to promote neuronal differentiation.
14534527 FLI1 interacts with EWS and their oncogenic fusion protein.
12875977 This study supports the role of Fli1 as a suppressor of collagen transcription in human skin in vivo.
12739001 overexpression of this protein affects cell growth and differentiation of K562 cells
12724402 Fli-1 and GATA-1 work together to activate the expression of genes associated with the terminal differentiation of megakaryocytes
12359731 role in regulating megakaryocyte-specific glycoprotein VI promoter

AA Sequence

MDGTIKEALSVVSDDQSLFDSAYGAAAHLPKADMTASGSPDYGQPHKINPLPPQQEWINQPVRVNVKREY      1 - 70
DHMNGSRESPVDCSVSKCSKLVGGGESNPMNYNSYMDEKNGPPPPNMTTNERRVIVPADPTLWTQEHVRQ     71 - 140
WLEWAIKEYSLMEIDTSFFQNMDGKELCKMNKEDFLRATTLYNTEVLLSHLSYLRESSLLAYNTTSHTDQ    141 - 210
SSRLSVKEDPSYDSVRRGAWGNNMNSGLNKSPPLGGAQTISKNTEQRPQPDPYQILGPTSSRLANPGSGQ    211 - 280
IQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTK    281 - 350
VHGKRYAYKFDFHGIAQALQPHPTESSMYKYPSDISYMPSYHAHQQKVNFVPPHPSSMPVTSSSFFGAAS    351 - 420
QYWTSPTGGIYPNPNVPRHPNTHVPSHLGSYY                                          421 - 452
//

Text Mined References (131)

PMID Year Title
27052461 2016 Large-scale production of megakaryocytes from human pluripotent stem cells by chemically defined forward programming.
26336820 2015 PI3K/AKT signaling modulates transcriptional expression of EWS/FLI1 through specificity protein 1.
26316623 2015 Paris-Trousseau thrombocytopenia is phenocopied by the autosomal recessive inheritance of a DNA-binding domain mutation in FLI1.
26305602 2015 Overexpression of Fli-1 is associated with adverse prognosis of endometrial cancer.
26261664 2015 A SMARCB1-deficient vulvar neoplasm with prominent myxoid stroma: report of a case showing ERG and FLI1 expression.
26159733 2015 Robust hematopoietic progenitor cell commitment in the presence of a conflicting cue.
26156017 2015 Friend leukemia virus integration 1 activates the Rho GTPase pathway and is associated with metastasis in breast cancer.
26063314 2015 Transdifferentiation of erythroblasts to megakaryocytes using FLI1 and ERG transcription factors.
26055516 2015 Epigenetic suppression of Fli1, a potential predisposing factor in the pathogenesis of systemic sclerosis.
25779942 2015 SLFN11 Is a Transcriptional Target of EWS-FLI1 and a Determinant of Drug Response in Ewing Sarcoma.
25712098 2015 EWS-FLI1 employs an E2F switch to drive target gene expression.
25504335 2014 Simultaneous downregulation of KLF5 and Fli1 is a key feature underlying systemic sclerosis.
25483190 2014 Ewing sarcoma EWS protein regulates midzone formation by recruiting Aurora B kinase to the midzone.
25472652 2015 Clinical Relevance of Plasma DNA Methylation in Colorectal Cancer Patients Identified by Using a Genome-Wide High-Resolution Array.
25453903 2014 EWS-FLI1 utilizes divergent chromatin remodeling mechanisms to directly activate or repress enhancer elements in Ewing sarcoma.
25421497 2015 A possible contribution of endothelial CCN1 downregulation due to Fli1 deficiency to the development of digital ulcers in systemic sclerosis.
25416956 2014 A proteome-scale map of the human interactome network.
25379017 2014 FLI1 expression is correlated with breast cancer cellular growth, migration, and invasion and altered gene expression.
25062258 2014 Immunolabeling for p16, WT1, and Fli-1 in the assignment of growth phase for cutaneous melanomas.
25057021 2014 Molecular dissection of the mechanism by which EWS/FLI expression compromises actin cytoskeletal integrity and cell adhesion in Ewing sarcoma.
24923303 2014 Oncogenic Fli-1 is a potential prognostic marker for the progression of epithelial ovarian cancer.
24735198 Primary subcutaneous spindle cell Ewing sarcoma with strong S100 expression and EWSR1-FLI1 fusion: a case report.
24708674 2014 Bosentan reverses the pro-fibrotic phenotype of systemic sclerosis dermal fibroblasts via increasing DNA binding ability of transcription factor Fli1.
24375017 2014 Flightless I over-expression impairs skin barrier development, function and recovery following skin blistering.
24292093 2014 Fli1 deficiency contributes to the suppression of endothelial CXCL5 expression in systemic sclerosis.
24124617 2013 Ewing sarcoma cells secrete EWS/Fli-1 fusion mRNA via microvesicles.
24100448 2013 Enrichment of FLI1 and RUNX1 mutations in families with excessive bleeding and platelet dense granule secretion defects.
24072183 2014 ERG and FLI1 protein expression in epithelioid sarcoma.
24058639 2013 Fli1 represses transcription of the human ?2(I) collagen gene by recruitment of the HDAC1/p300 complex.
24055811 2013 Flightless I homolog negatively regulates ChREBP activity in cancer cells.
23940108 2013 Oncogenic ETS fusions deregulate E2F3 target genes in Ewing sarcoma and prostate cancer.
23926301 2013 Deregulation of ETS1 and FLI1 contributes to the pathogenesis of diffuse large B-cell lymphoma.
23774214 2013 14-3-3 proteins modulate the ETS transcription factor ETV1 in prostate cancer.
23667468 2013 Fli-1 overexpression in hematopoietic progenitors deregulates T cell development and induces pre-T cell lymphoblastic leukaemia/lymphoma.
23663495 2013 Adenosine A(2A) receptors promote collagen production by a Fli1- and CTGF-mediated mechanism.
23518636 2013 Diagnostic utility of Fli-1 and D2-40 in distinguishing atypical fibroxanthoma from angiosarcoma.
23441188 2013 Genomic EWS-FLI1 fusion sequences in Ewing sarcoma resemble breakpoint characteristics of immature lymphoid malignancies.
23327922 2013 Activity of a heptad of transcription factors is associated with stem cell programs and clinical outcome in acute myeloid leukemia.
23178492 2013 Mechanism and relevance of EWS/FLI-mediated transcriptional repression in Ewing sarcoma.
23165331 2013 Study of EWS/FLI-1 rearrangement in 18 cases of CK20+/CM2B4+ Merkel cell carcinoma using FISH and correlation to the differential diagnosis of Ewing sarcoma/peripheral neuroectodermal tumor.
23145994 2012 Junction region of EWS-FLI1 fusion protein has a dominant negative effect in Ewing's sarcoma in vitro.
23049088 2012 A genome-wide association study provides evidence for association of chromosome 8p23 (MYP10) and 10q21.1 (MYP15) with high myopia in the French Population.
23041765 2012 Ciprofloxacin has antifibrotic effects in scleroderma fibroblasts via downregulation of Dnmt1 and upregulation of Fli1.
22965552 2013 Transcription factors Fli1 and EKLF in the differentiation of megakaryocytic and erythroid progenitor in 5q- syndrome and in Diamond-Blackfan anemia.
22930730 2012 Targeting the EWSR1-FLI1 oncogene-induced protein kinase PKC-? abolishes ewing sarcoma growth.
22887642 2012 SNP array and phenotype correlation shows that FLI1 deletion per se is not responsible for thrombocytopenia development in Jacobsen syndrome.
22446963 2012 Meta-analysis identifies nine new loci associated with rheumatoid arthritis in the Japanese population.
22372906 2012 Utility of immunohistochemical staining with FLI1, D2-40, CD31, and CD34 in the diagnosis of acquired immunodeficiency syndrome-related and non-acquired immunodeficiency syndrome-related Kaposi sarcoma.
22086061 2012 Tumor-specific retargeting of an oncogenic transcription factor chimera results in dysregulation of chromatin and transcription.
22081504 2012 FLI1 is a novel ETS transcription factor involved in gene fusions in prostate cancer.
21931859 2011 Multiple ETS family proteins regulate PF4 gene expression by binding to the same ETS binding site.
21917756 2011 Abnormal expression of FLI1 protein is an adverse prognostic factor in acute myeloid leukemia.
21643012 2011 A novel oncogenic mechanism in Ewing sarcoma involving IGF pathway targeting by EWS/Fli1-regulated microRNAs.
21633373 2011 FLI1 polymorphism affects susceptibility to cutaneous leishmaniasis in Brazil.
21571218 2011 Genome-wide analysis of simultaneous GATA1/2, RUNX1, FLI1, and SCL binding in megakaryocytes identifies hematopoietic regulators.
21451544 2011 Fli1 is a negative regulator of estrogen receptor ? in dermal fibroblasts.
21321929 2011 The c-Abl tyrosine kinase controls protein kinase C?-induced Fli-1 phosphorylation in human dermal fibroblasts.
21087477 2010 A GA microsatellite in the Fli1 promoter modulates gene expression and is associated with systemic lupus erythematosus patients without nephritis.
20933505 2010 FOXO1 is a direct target of EWS-Fli1 oncogenic fusion protein in Ewing's sarcoma cells.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20879862 2010 Downregulation of Friend leukemia virus integration 1 as a feedback mechanism that restrains lipopolysaccharide induction of matrix metalloproteases and interleukin-10 in human macrophages.
20676125 2010 A previously unrecognized promoter of LMO2 forms part of a transcriptional regulatory circuit mediating LMO2 expression in a subset of T-acute lymphoblastic leukaemia patients.
20665663 2010 The Ewing's sarcoma fusion protein, EWS-FLI, binds Runx2 and blocks osteoblast differentiation.
20382729 2010 EWS-FLI-1 modulates miRNA145 and SOX2 expression to initiate mesenchymal stem cell reprogramming toward Ewing sarcoma cancer stem cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20308673 2010 Impact of EWS-ETS fusion type on disease progression in Ewing's sarcoma/peripheral primitive neuroectodermal tumor: prospective results from the cooperative Euro-E.W.I.N.G. 99 trial.
20308669 2010 Current treatment protocols have eliminated the prognostic advantage of type 1 fusions in Ewing sarcoma: a report from the Children's Oncology Group.
20228226 2010 Endothelial Fli1 deficiency impairs vascular homeostasis: a role in scleroderma vasculopathy.
20103643 2010 EWS/FLI1 oncogene activates caspase 3 transcription and triggers apoptosis in vivo.
20019092 2010 The EWS/FLI1 oncogenic protein inhibits expression of the Wnt inhibitor DICKKOPF-1 gene and antagonizes beta-catenin/TCF-mediated transcription.
19859563 2009 GLI1 is a central mediator of EWS/FLI1 signaling in Ewing tumors.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19530039 2009 Friend leukemia virus integration-1 (FLI-1) expression in gastrointestinal stromal tumors.
19417137 2009 Ewing sarcoma fusion protein EWSR1/FLI1 interacts with EWSR1 leading to mitotic defects in zebrafish embryos and human cell lines.
19349856 2009 Immunohistochemical evaluation of FLI-1 in acute lymphoblastic lymphoma (ALL): a potential diagnostic pitfall.
19158279 2009 Phosphorylation of Fli1 at threonine 312 by protein kinase C delta promotes its interaction with p300/CREB-binding protein-associated factor and subsequent acetylation in response to transforming growth factor beta.
18785112 2008 Fli-1 expression in malignant melanoma.
18648544 2008 IGF1 is a common target gene of Ewing's sarcoma fusion proteins in mesenchymal progenitor cells.
18414662 2008 EWS/FLI mediates transcriptional repression via NKX2.2 during oncogenic transformation in Ewing's sarcoma.
18174230 2008 Association of polymorphisms in complement component C3 gene with susceptibility to systemic lupus erythematosus.
17884818 2007 Transforming growth factor-beta regulates DNA binding activity of transcription factor Fli1 by p300/CREB-binding protein-associated factor-dependent acetylation.
17727680 2007 Functional roles of Fli-1, a member of the Ets family of transcription factors, in human breast malignancy.
17163154 2006 EWS-FLI1 in Ewing's sarcoma: real targets and collateral damage.
16990252 2006 Interplay of Fli-I and FLAP1 for regulation of beta-catenin dependent transcription.
16964281 2007 Ewing's sarcoma fusion protein, EWS/Fli-1 and Fli-1 protein induce PLD2 but not PLD1 gene expression by binding to an ETS domain of 5' promoter.
16930139 2006 Transcription factor Fli-1 expression by bone marrow cells in chronic myeloproliferative disorders is independent of an underlying JAK2 (V617F) mutation.
16829517 2006 Fli1 and Ets1 have distinct roles in connective tissue growth factor/CCN2 gene regulation and induction of the profibrotic gene program.
16802366 2006 Association between enhanced type I collagen expression and epigenetic repression of the FLI1 gene in scleroderma fibroblasts.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16148010 2005 FLI-1 functionally interacts with PIASxalpha, a member of the PIAS E3 SUMO ligase family.
15919668 2005 Inhibition of platelet-derived growth factor-induced cell growth signaling by a short interfering RNA for EWS-Fli1 via down-regulation of phospholipase D2 in Ewing sarcoma cells.
15809330 2005 The FLI-1 transcription factor is a short-lived phosphoprotein in T cells.
15798196 2005 Identification of nuclear import and export signals within Fli-1: roles of the nuclear import signals in Fli-1-dependent activation of megakaryocyte-specific promoters.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15282325 2004 EWS/FLI-1 silencing and gene profiling of Ewing cells reveal downstream oncogenic pathways and a crucial role for repression of insulin-like growth factor binding protein 3.
15273724 2004 Role of protein-protein interactions in the antiapoptotic function of EWS-Fli-1.
15232614 2004 FLI1 monoallelic expression combined with its hemizygous loss underlies Paris-Trousseau/Jacobsen thrombopenia.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15021903 2004 The effects of Brn-3a on neuronal differentiation and apoptosis are differentially modulated by EWS and its oncogenic derivative EWS/Fli-1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14534527 2003 Homotypic and heterotypic interactions of EWS, FLI1 and their oncogenic fusion protein.
12875977 2003 Persistent down-regulation of Fli1, a suppressor of collagen transcription, in fibrotic scleroderma skin.
12743594 2003 EAPII interacts with ETS1 and modulates its transcriptional function.
12739001 2003 Effects of overexpression of the Ets family transcription factor TEL on cell growth and differentiation of K562 cells.
12724402 2003 Protein-protein interaction between Fli-1 and GATA-1 mediates synergistic expression of megakaryocyte-specific genes through cooperative DNA binding.
12556498 2003 Functional cross-antagonism between transcription factors FLI-1 and EKLF.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12359731 2002 Cloning and analysis of the thrombopoietin-induced megakaryocyte-specific glycoprotein VI promoter and its regulation by GATA-1, Fli-1, and Sp1.
11118632 2000 Presence of new alternative exons in human and mouse Fli-1 genes.
10949935 2000 A novel zinc finger gene is fused to EWS in small round cell tumor.
10891501 2000 Hemorrhage, impaired hematopoiesis, and lethality in mouse embryos carrying a targeted disruption of the Fli1 transcription factor.
10827180 2000 The splicing factor U1C represses EWS/FLI-mediated transactivation.
10606656 2000 The mechanism of complex formation between Fli-1 and SRF transcription factors.
9764825 1998 Fli-1b is generated by usage of differential splicing and alternative promoter.
9751743 1998 Chromosome translocation based on illegitimate recombination in human tumors.
9681824 1998 Erg proteins, transcription factors of the Ets family, form homo, heterodimers and ternary complexes via two distinct domains.
9651344 1998 The ets family member Tel binds to the Fli-1 oncoprotein and inhibits its transcriptional activity.
9010223 1997 FLI1 and EWS-FLI1 function as ternary complex factors and ELK1 and SAP1a function as ternary and quaternary complex factors on the Egr1 promoter serum response elements.
8679708 1996 Characterization of the human and mouse Fli-1 promoter regions.
8604338 1996 SRE elements are binding sites for the fusion protein EWS-FLI-1.
8439553 1993 Human FLI-1 localizes to chromosome 11Q24 and has an aberrant transcript in neuroepithelioma.
8339272 1993 Chimeric EWS-FLI1 transcript in a Ewing cell line with a complex t(11;22;14) translocation.
8246959 1993 The Ewing's sarcoma EWS/FLI-1 fusion gene encodes a more potent transcriptional activator and is a more powerful transforming gene than FLI-1.
8039423 1994 Cloning of the entire FLI1 gene, disrupted by the Ewing's sarcoma translocation breakpoint on 11q24, in a yeast artificial chromosome.
7773776 1994 Solution structure of the ets domain of Fli-1 when bound to DNA.
7542907 1995 Molecular analysis of a t(11;22) translocation junction in a case of Ewing's sarcoma.
1845910 1991 Identification of a common viral integration region in Cas-Br-E murine leukemia virus-induced non-T-, non-B-cell lymphomas.
1765382 1991 The human homolog of the mouse common viral integration region, FLI1, maps to 11q23-q24.
1522903 1992 Gene fusion with an ETS DNA-binding domain caused by chromosome translocation in human tumours.
1445800 1992 The ERGB/Fli-1 gene: isolation and characterization of a new member of the family of human ETS transcription factors.
1394211 1992 Structure and expression of human Fli-1 gene.