Property Summary

NCBI Gene PubMed Count 268
PubMed Score 979.47
PubTator Score 753.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
esophageal adenocarcinoma -3.500 2.0e-02
psoriasis 1.200 4.4e-04
periodontitis -1.300 6.4e-12
Atopic dermatitis -2.200 6.3e-03

Gene RIF (289)

PMID Text
27012026 Filaggrin polymorphism Pro478Ser Is associated with increased disease severity and staphylococcus aureus colonization in atopic dermatitis patients.
26830116 Filaggrin genotype does not determine the skin's threshold to UV-induced erythema.
26472199 Supplementation with the PPARalpha agonist WY14643 improved the homeostasis and barrier function of filaggrin deficient skin models by normalization of the free fatty acid profile.
26381575 Letter: Knockdown of either filaggrin or loricrin increases the productions of interleukin (IL)-1alpha, IL-8, IL-18 and granulocyte macrophage colony-stimulating factor in stratified human keratinocytes.
26282804 Filaggrin null mutation and sunlight exposure is associated in the development of atopic eczema.
26071937 Filaggrin breakdown products determine corneocyte conformation in patients with atopic dermatitis
26026341 TSLP downregulates filaggrin expression in human skin keratinocytes
25863977 IL-33 increases the skin barrier permeability to allergens by downregulating the expression of filaggrin in atopic dermatitis.
25816564 It is an essential skin barrier protein.
25776938 Filaggrin expression was present in healthy skin
25757221 Study investigated the 4 most prevalent European FLG mutations (c.2282del4, p.R501X, p.R2447X, and p.S3247X) in two samples including 759 and 450 atopic dermatitis families and found that overall, children of FLG-carrier mothers had a 1.5-fold increased AD risk (S1 = 1.50, Pmeta-analysis = 8.4 x 10-8).
25747786 this is the first study to our knowledge to assess whether FLG mutations are associated with chronic rhinosinusitis and we found no evidence of an association in our series of patients
25734812 Loss of mutation of filaggrin is not associated with chronic actinic dermatitis.
25712346 Our findings indicate an association between xerosis and asthma in men independent of atopic dermatitis and FLG mutations.
25678087 There was no association between FLG mutations and food allergen and aeroallergen sensitization, respectively
25660180 Thirty-five percent of keratosis pilaris patients displayed filaggrin mutations, demonstrating that filaggrin mutations only partially account for the KP phenotype.
25659224 Filaggrin mutations affected the lifetime prevalence of hand and foot dermatitis in participants with a history of AD
25620092 Loss-of-function variants of the filaggrin gene are associated with clinical reactivity to foods
25581911 Results suggest that skin reaction and regeneration response was more rapid amongst individuals with AD who carried the mutation for FLG
25580797 FLG has been, and still remains the major susceptibility gene in patients with AD.
25564772 We sought to explain the associated severe nonlesional skin dryness in our African American children with atopic dermatitis by genotyping a previously described European dose-dependent risk factor for AD, intragenic FLG repeats, or CNV.
25528737 genetic polymorphism is associated with asthma in Taiwanese children with mite allergy
25390410 Filaggrin mutations in a Western siberian population and their association with atopic dermatitis in children
25383447 Carriage of FLG mutations was not associated with the risk of cervical cancer.
25314673 the 2282del4 mutation was associated only with atopic dermatitis (AD) that developed during infancy or in early childhood, not with AD development in late childhood or adulthood; similar associations also observed for the combined 2282del4 or R501X genotype
25282568 Early-life environmental peanut exposure is loss-of-function mutation is associated with an increased risk of peanut sensitization and allergy in children
25277085 Allergic sensitization and eczema modulated the association between FLG variants and asthma but not rhinitis.
25230061 In Iranian patients, this study demonstrated that there was no significant association between polymorphisms of FLG gene variants and AD.
25174864 loss-of-function mutations are associated with food allergies in older children through eczema and food allergen sensitization during early childhood
25086748 The FLG loss-of-function mutation frequency was not significantly different between the atopic dermatitis and non-AD groups in a cohort of children from Ishigaki Island
25065719 this article reviews the various causes of low filaggrin levels, centralizing the functional and morphologic role of a deficiency in filaggrin, its metabolites, or both in the etiopathogenesis of atopic dermatitis. [review]
24940654 Knockdown of filaggrin in a three-dimensional reconstructed human epidermis impairs keratinocyte differentiation.
24920311 data demonstrate a prevalence of filaggrin mutations in the African American population that exceeds previously published data, although the overall prevalence is still lower than in other populations
24912553 no evidence of correlation between gene expression and promoter methylation in skin and buccal samples
24905740 FLG loss-of-function mutations were associated with higher incidence of HPV-related cancers and pre-cancers that are potentially screening and vaccine preventable.
24880632 Extracellular space and lipid metabolism are important in atopic skin pathology independent of FLG genotype, whereas an aberrant defense response is seen in subjects with FLG mutations.
24858702 study indicates that the filaggrin gene mutation c.3321delA is associated with clinical phenotypes of atopic dermatitis in the Chinese Han population
24819286 lack of significant diversity in skin pH in relation to filaggrin mutation carrier status suggests that the effect of filaggrin mutations on skin pH i
24813994 These findings suggest that filaggrin-2 may play an overlapping role with filaggrin in epithelial cornification; however, it may also have a partially distinct role in the molecular processes of cornification.
24726196 Filaggrin is overexpressed in lesional chronic idiopathic urticaria (CIU) skin, and increased filaggrin expression is positively correlated with urticaria severity in CIU.
24708301 The coexistence of allergic disorders is frequent, and allergic sensitization and FLG variants jointly increased risk of allergic comorbidities, which may represent more severe and complex clinical phenotypes.
24629053 These results indicate that FLG mutations might be involved in the pathogenesis of wheat-dependent exercise-induced anaphylaxis in the family studied.
24628370 Results show that among participants aged over 60 years at baseline, we found statistically significant lower risks of all cancers and NMSC among FLG mutation carriers.
24565632 FLG mutations are common in a US group of white patients with severe atopic dermatitis
24521637 The results of the present study suggest that the FLG P478S polymorphism alone and combined with other factors influences FFA levels and increases the susceptibility to atopic dermatitis
24401911 Diminished filaggrin mutation found in patients diagnosed with chronic atopic dermatitis.
24369804 mutations are not a significant contributor to atopic dermatitis in South African amaXhosa patients
24251354 Results suggest that patients with FLG mutant-type AD may have a higher risk of allergic sensitization compared with patients with the wild-type.
24247645 The lack of filaggrin expression observed in the corneal specimens from atopic dermatitis patients is not due to the two most common filaggrin mutations (R501X, 2282del4) but is most likely secondary to inflammation.
24157460 Filaggrin is a predominant member of the denaturation-resistant nickel-binding proteome of human epidermis
24111531 Increased efficacy of omalizumab in atopic dermatitis patients with wild-type filaggrin status and higher serum levels of phosphatidylcholines.
24102300 In this study, an increased risk of hand eczema conferred by FLG mutations could not be shown, but subjects with concomitant FLG mutations and atopic dermatitis showed the highest risk of hand eczema during traineeships.
24061166 The interplay of the UCA/PCA and the sPLA2/NHE-1 acidification pathways of the skin and the impact of FLG insufficiency on skin lipid composition and organization in reconstructed skin are described.
24054371 Knowing the FLG mutational status in this family was helpful in predicting who was at risk of developing atopic dermatitis.
23947670 All thirty-seven R501X/2282del4 compound heterozygous individuals were found to carry the two mutations in trans position.
23927042 Study investigated the role of filigrin homozygous mutations in basal cell carcinoma and found no evidence of elevated risk.
23867897 We investigated whether FLG mutation inheritance, skin barrier impairment, and atopic dermatitis also predispose to allergic sensitization to foods.
23848345 Sensitization for type I allergens did not differ between FLG loss-of-function mutation carriers and wild-type subjects. For type IV allergens, more FLG loss-of-function carriers were sensitized to lanolin and p-tert-butylphenol-formaldehyde resin.
23744309 Three FLG mutations have been identified in the selected families with ichthyosis vulgaris, and the 3321delA mutation was most prevalent (46.9%).
23684069 the relationship between peanut allergy and FLG loss-of-function mutations
23657503 IL-25 enhances herpes simplex virus (HSV)-1 and vaccinia virus replication by inhibiting filaggrin expression, and IL-25 acts synergistically with IL-4 and IL-13 to enhance HSV-1 replication in vitro
23645350 Filaggrin was detectable in a subfraction of oral squamous carcinomas and was restricted to keratinising areas of the carcinomas
23629652 KLK5 is required for biochemical processing of profilaggrin in human skin.
23622014 Food sensitization in Japanese infants is associated with a common Filaggrin variant
23601069 an inherited barrier abnormality resulting from FLG mutations may potentially have an increased risk of developing protein contact dermatitis
23548340 loss-of-function mutations in the FLG gene were significantly associated with self-reported food allergy and alcohol sensitivity, but not with oral allergy syndrome
23460889 Filaggrin genotype was used as instrumental variable for vitamin D status.
23421459 Study shows further genotype-phenotype correlations in patients with occupational irritant contact eczema and FLG mutation carrier status.
23343419 FLG mutation carriers with self-reported dermatitis have an increased risk of contact sensitization to substances other than nickel, whereas FLG mutations alone may not, or may only slightly, increase the risk of sensitization.
23301728 Ichthyosis vulgaris is caused by loss-of-function mutations in the filaggrin gene (FLG)
23297869 A complete, but not a partial filaggrin deficiency is associated with moderate changes in TEWL and skin hydration, revealing surprisingly only a mild disturbance of the epidermal permeability barrier function
23290076 Analyses of FLG mutation frequency and filaggrin expression in isolated ichthyosis vulgaris (IV) and atopic dermatitis-associated IV.
23273645 Our study indicates the possibility that impaired tight junction barriers affect polar lipids and profilaggrin processing by disturbing the pH condition of the stratum corneum.
23166590 In children, filaggrin mutations seem to define a specific endotype of atopic dermatitis primarily characterized by predilection to exposed areas of the body, in particular hands and cheeks.
23154627 Filaggrin has an association with atopic dermatis and has a role in epidermal barrier function.
23152869 The present family samples confirmed the susceptibility of mutation 3321delA to atopic dermatitis in Han Chinese. K4671X was not a pathogenic mutation.
23078034 Our results in general indicate a low frequency of FLG null mutations in the studied Croatian population supporting a theory of a latitude-dependent distribution of FGL null mutations in Europe.
23063684 the results of this study indicate that cholesterol sulfate induces filaggrin expression through increased RORalpha expression.
23039796 Results indicate that both FLG mutations and AD increase the risk of ICD. Concurrent FLG mutations and AD are at highest risk.
22989708 In Turkish children, FLG R501X genotyping revealed no risk alleles in variable severities of atopic dermatitis
22964107 FLG mutations do not increase the risk of food allergy over and above that of food sensitization among1-year-old infants.
22962861 Filaggrin loss-of-function mutations and atopy may alter the clinical course of irritant contact dermatitis (ICD).
22960809 A review discusses the structure and function of filaggrin, basic genetics, type of mutations in filaggrin gene, and association of such mutations with different dermatoses.
22951058 Children with FLG null mutations were more likely to have persistent atopic dermatitis.
22921868 mutations are associated with skin barrier abnormality and increased serum 25-hydroxyvitamin D concentrations
22903496 mutations presented an interaction with sensitization to peanut in atopic dermatitis
22897780 study presents pictures of healthy and diseased hands from individuals with filaggrin gene (FLG) mutations to describe a clinical entity of hand eczema
22742591 no significant difference (P > 0.05) was found between the expression of the FLG gene by control cells and NCTC 2544 cells treated with Plantaricin A.
22635822 Our results revealed no significant association between filaggrin mutations and chronic allergic keratoconjunctivitis.
22622429 Profilaggrin AB domain provides a key feedback mechanism that controls epidermal homeostasis.
22612618 Loss of function FLG alleles were first identified as causative of ichthyosis vulgaris and were subsequently found to be major predisposing factors for atopic dermatitis and atopic disorders
22418870 Two FLG SNPs rs11584427 and rs1933064 were in complete linkage disequilibrium
22407025 study indicated that rare mutations, such as p.K4022X, in FLG gene may be associated with psoriasis in Chinese population.
22403702 a combination of FLG variants and allergic sensitization increased the risk of eczema in subsequent years
22381027 In this study, the most marked increase in the prevalence of FLG mutations across the birth cohorts was observed among individuals who reported Atopic diseases (AD). Albeit not significant, this increase might suggest that carriers of FLG mutations have been more susceptible to the changes in environmental exposure that have resulted in AD.
22360978 FLG mutations increase the risk for persistent dry skin, persistent eczema, and AE and non-AE at age 8 years.
22322004 Atopic dermatitis (AD) with Filaggrin (FLG) mutations is associated with an increased SC IL-1 cytokine profile; this profile is also seen in a murine homologue of filaggrin deficiency.
22299762 we have identified two novel null mutations (including one de novo mutation) and a known mutation three Chinese ichthyosis vulgaris pedigrees, extending the FLG mutation spectrum of functional variants that possibly cause this condition.
22288457 The skin barrier disruptions of atopic eczema associated with loss-of-function mutations in filaggrin are thought to provide a nidus for allergic sensitization to food and aeroallergens
22229441 IL-17A downregulates in keratinocytes the expression of filaggrin and genes important for cellular adhesion, which could affect epidermal barrier formation.
22220561 clearly demonstrated that FLG loss-of-function mutations were significantly associated with AD in northern China
22182180 No association between filaggrin gene mutation and early onset of psoriasis.
22177328 This study suggests that IL-31 is an important regulator of keratinocyte differentiation and demonstrates a link between the presence of IL-31 in skin, as found in patients with atopic dermatitis, and filaggrin expression
22158554 Mutations in the filaggrin (FLG) gene are the cause of ichthyosis vulgaris-the most common disorder of keratinization-and also a strong genetic risk factor for atopic eczema.
22088612 FLG null mutations modified the effects of smoking on the risk of asthma.
22071473 Copy number variation within FLG makes a significant, dose-dependent contribution to atopic dermatitis risk.
22030464 Early food sensitization and the presence of an FLG mutation in infants with early eczema increase the risk for later asthma
21999178 In this review, transgenic mice deficient in filaggrin show eczematous skin lesions similar to atopic dermatitis.
21991953 Mutations in the filaggrin gene (FLG) are among the most common and profound single-gene defects identified to date in the causation and modification of disease [review]
21983738 FLG gene might be associated with atopic dermatitis susceptibility in southern Chinese Han population.
21945601 Filaggrin defects can synergize with steroid sulfatase deficiency to exacerbate the ichthyosis phenotype.
21923691 The two mutations in Japanese are rare in Korean women with atopic dermatitis.
21923666 Two novel filaggrin mutations (S1302X and Q2397X) and two recurrent mutations (3321delA and K4671X) were identified in patients with atopic asthma.
21790526 The results highlight a novel association between Filaggrin-null mutations and an increased susceptibility to recurrent bacterial skin infection among patients with Atopic Dermatitis
21777221 Results show Filaggrin loss-of-function mutations increase the risk of atopic dermatitis and dry skin and also the risk of fissures on the hands and/or fingers in subjects without atopic dermatitis
21723775 basal expression of MMP-2, MMP-9, MMP-28, and Filaggrin was evaluated in oral keratinocytes to collect information about ability of cigarette smoke to modify basal expression pattern of these key enzymes in the absence of clinical signs in oral epithelium
21701148 The low frequency of filaggrin mutations was surprising since 42.7% of our keratoconus population had atopic dermatitis.
21692775 FLG loss-of-function-variants are less common in patients with ichthyosis vulgaris and atopic dermatitis in the Ethiopian population; the other factors may be of importance in the pathogenesis in this ethnic group
21576945 summary of genome-wide screening of atopic dermatitis susceptibility loci, filaggrin biochemistry and recent epidemiological studies on filaggrin mutations and allergic diseases [review]
21518425 Since the observation of a strong association of "loss of function" mutations in the filaggrin gene with AD, the epidermal barrier was rediscovered as important pathophysiological co-factor of this disease.
21514438 filaggrin deficiency provokes alterations in keratinocyte architecture that influence epidermal functions localizing to the extracellular matrix
21501248 Individuals who are homozygous for 228del4 and R501X filaggrin null mutation do not always develop dermatitis and complete long-term remission is possible.
21496060 Results suggest that the types of FLG mutations may be much more plentiful in atopic dermatitis than in ichthyosis vulgaris.
21434976 the subset of patients with both atopic dermatitis and contact allergy represent a phenotype of atopic dermatitis that is not associated with FLG mutations
21426411 Significant interactions between the 2282del4 FLG mutation and the CT genotype for IL-13 or GG genotype for IL-10 and a higher risk for developing atopic dermatitis were demonstrated.
21410766 Our results provide distinct phenotype correlations and new supportive evidence for compromised barrier function and skin lipid composition in atopic dermatitis carriers of the prevalent European FLG loss-of-function alleles.
21365004 In a Polish population FLG 2282del4 and R501X carriage increases risk for development of atopic dermatitis(AD) and atopic asthma (also in the absence of AD or history thereof).
21326297 Filaggrin null mutations are not a protective factor for acne vulgaris.
21289640 only a small percentage of Italian patients with atopic eczema carry mutations in the FLG gene
21261659 Multiple regression analysis showed that natural moisturizing factor (NMF) levels were independently associated with FLG genotype and severity of atopic dermatitis disease.
21255094 Reduced filaggrin levels may influence innate immune responses via TLR stimuli and may contribute to the pathogenesis of inflammatory skin disease via TSLP expression.
21219289 FLG P478S polymorphism may confer susceptibility to the development of AD among Chinese individuals and may be modified by IgE levels.
21166815 study suggested that FLG null mutations may increase the risk of self-reported nickel dermatitis in subjects with atopic dermatitis, and also that null mutations may lower the age at onset of nickel dermatitis
21137118 FLG mutation carriers had a more than four times higher risk of developing eczema by 3 months of age compared with children without FLG mutations, and this has also been suggested previously by a number of cross-sectional studies in older children.
21074596 No association between filaggrin null mutations and type I latex allergy was found (p=0.24). Patients with type I latex allergy more often reported contact dermatitis.
21074596 Observational study of gene-disease association. (HuGE Navigator)
21039602 FLG mutations are strong predisposing factors for AD in Han Chinese.
21039602 Observational study of gene-disease association. (HuGE Navigator)
20975288 filaggrin does not appear to have a downstream effect on the development of allergic disease
20975288 Observational study of gene-disease association. (HuGE Navigator)
20962854 Atopic dermatitis patients, irrespective of their filaggrin genotype, have an altered skin barrier implying that other factors besides FLG loss-of-function mutations modulate skin barrier integrity
20943104 possibility of the R501X mutation as being one of the major causes of ichthyosis vulgaris and possibility of the presence of novel FLG gene mutations
20865458 Case selection may be responsible for overestimating the prevalence of FLG mutations in atopic disease.
20865458 Observational study of gene-disease association. (HuGE Navigator)
20814636 Letter: speculate that the special phenotype of atopic hand eczema identified in previous reports may be explained consistently by null-mutations in the profilaggrin gene.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20686498 27.8% of Japanese atopic eczema complicated with asthma patients carried one or more of the eight FLG mutations
20686498 Observational study of gene-disease association. (HuGE Navigator)
20629673 No association was found between nickel allergy, hand eczema at first appearance or occurrence of dermatitis, and filaggrin mutations. However, patients with filaggrin mutations had an earlier age of onset and a trend towards longer duration of disease.
20629673 Observational study of gene-disease association. (HuGE Navigator)
20621340 Observational study of gene-disease association. (HuGE Navigator)
20573035 genetic polymorphism is associated with asthma characterized by the early onset
20573035 Observational study of gene-disease association. (HuGE Navigator)
20513523 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20500796 Filaggrin null mutations associated with significantly (P<0.05) higher frequencies of allergen-specific CD4+ T-helper 2 cell responses.
20445547 Despite grossly normal stratum corneum morphology, filaggrin-deficient skin models showed a disturbed diffusion barrier function
20426775 FLG null mutations are significantly associated with hand eczema in subjects with atopic dermatitis.
20426775 Observational study of gene-disease association. (HuGE Navigator)
20346018 A crude analysis on women who did not have ear piercings revealed a positive association between FLG null mutations and nickel sensitization as well as between FLG null mutations and allergic nickel dermatitis.
20346018 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20230798 Sphingosylphosphorylcholine down-regulates FLG gene transcription through NOX5-based NADPH oxidase and COX-2 in human keratinocytes.
20222934 Three mutations - one novel mutation (Q1256X) and two known mutations (3321delA and E2422X) - were identified in Chinese patients with ichthyosis vulgaris
20208004 expression of the epidermal differentiation complex genes filaggrin and involucrin was strongly decreased directly by IL-13.
20179351 ELA2 localized to keratohyalin granules, where it was found to directly participate in (pro-)filaggrin processing.
20159264 specific null mutations in the filaggrin gene were found to be associated with allergen sensitization
20149601 Both steroid sulfatase and filaggrin mutations are found in X-linked ichthyosis.
20132155 Our results confirm previous observations of altered ceramide levels in atopic dermatitis, which however appear to show no clear relationship with filaggrin mutations
20109745 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20028371 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20016199 Observational study of gene-disease association. (HuGE Navigator)
19958351 Mutations at any site within FLG cause significant reductions in amounts of profilaggrin/filaggrin peptide in patient epidermis as the C-terminal region is essential for proper processing of profilaggrin into filaggrin.
19874431 a strong association of the FLG mutations with atopic dermatitis. Subgroup analysis revealed a significantly higher proportion of patients with an early age of disease onset and significantly higher median serum IgE levels among mutation carriers
19874431 Observational study of gene-disease association. (HuGE Navigator)
19863505 Mutations were found in japanese patients with atopic dermatitis and ichthyosis vulgaris.
19863505 Observational study of gene-disease association. (HuGE Navigator)
19839980 FLG mutations combined with eczema in the first year of life are associated with a later development of asthma and hay fever; cat exposure enhances the effect of a FLG mutation on the development of eczema and sensitization.
19839980 Observational study of gene-disease association. (HuGE Navigator)
19804695 Heterogeneity-based genome scan meta-analysis confirms the region encoding CD80, CD86, and interleukins on chromosomes 3 and 5. The filaggrin gene (FLG) may be the susceptibility factor.5pter-p15.1 represents new significant loci not reported previously.
19785597 coinheritance of mutations in keratin 16 and filaggrin may aggravate the pachyonychia congenita phenotype
19733298 The R501X mutation in the gene encoding filaggrin, one of the strongest genetic predictors of atopic dermatitis, confers an even greater risk for atopic dermatitis eczema herpeticum in both European and African ancestry populations
19733298 Observational study of gene-disease association. (HuGE Navigator)
19720210 Patients with atopic dermatitis have an acquired defect in filaggrin expression that can be modulated by the atopic inflammatory response.
19681860 Filaggrin haploinsufficiency appears to be highly penetrant when all relevant skin features are included in the analysis.
19681860 Observational study of gene-disease association. (HuGE Navigator)
19663875 FLG mutations are significantly associated with atopic eczema in the Japanese population.
19663875 Observational study of gene-disease association. (HuGE Navigator)
19602001 Heterozygous carriage of R501X mutation was only found in four male patients, and associated with long-term disease severity. FLG mutations prevalent in Caucasian and other Asian populations are rarely found in our series.
19602001 Observational study of gene-disease association. (HuGE Navigator)
19601998 Observational study of gene-disease association. (HuGE Navigator)
19601982 The Th cell cytokine-induced up-regulation of MAP17 expression may be linked to the down-regulation of filaggrin in normal epidermal keratinocytes, which may be associated with abnormal epidermal differentiation observed in the dermatological diseases.
19589816 Meta-analysis of gene-disease association. (HuGE Navigator)
19550302 association between mutations in FILAGGRIN and atopic dermatitis; review on role skin barrier in the etiopathogenesis
19538357 a highly significant association of the FLG null variants R501X- and 2282del4 with AD (combined genotype p < 0.0001) and asthma (combined genotype p < 0.0001) was found.
19538357 Observational study of gene-disease association. (HuGE Navigator)
19538184 Heterozygosity for nonfunctional mutations in the FLG gene may contribute to the manifestation and maintenance of a particular chronic hand eczema (CHE) subtype that is characterized by the combination of allergic and irritant contact dermatitis.
19538184 Observational study of gene-disease association. (HuGE Navigator)
19515043 Filaggrin expression is not altered in superficial koilocytotic cells' foci in Epidermodysplasia verruciformis
19501237 This meta-analysis summarizes the strong evidence for a high eczema risk conferred by FLG mutations and refines their risk profiles, suggesting an association with more severe and secondary care disease.
19501237 Observational study of gene-disease association. (HuGE Navigator)
19492053 carrier status for common filaggrin mutations does not affect hearing in children
19492053 Observational study of gene-disease association. (HuGE Navigator)
19408338 Filaggrin loss-of-function variants are associated with atopic comorbidity in pediatric inflammatory bowel disease.
19408338 Observational study of gene-disease association. (HuGE Navigator)
19348926 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19247692 Observational study of gene-disease association. (HuGE Navigator)
19239468 Loss-of-function mutations in the gene encoding FLG are linked with IV in Northern European and Japanese populations and results here demonstrate that FLG mutations are also associated with IV in a Bangladeshi population.
19183181 mutations R501X and 2282del4 represent the most frequent genetic cause in German Ichthyosis Vulgaris patients.
19134432 nickel sensitization in relation to FLG deficiency; new knowledge concerning loss-of-function mutations in FLG suggests an additive effect from irritants & nickel may aggravate hand eczema in individuals with loss-of-function FLG mutations [review]
19037238 There are 2 rare mutations in the gene encoding filaggrin in Japanese patients with ichthyosis vulgaris and atopic dermatitis.
18987673 Heterozygous null alleles in filaggrin contribute to clinical dry skin in young adults and the elderly.
18987673 Observational study of gene-disease association. (HuGE Navigator)
18976374 filaggrin mutations in atopic hand eczema [review]
18843291 Ichthyosis, follicular atrophoderma, and hypotrichosis caused by mutations in ST14 is associated with impaired profilaggrin processing.
18818676 experimentally demonstrable skin barrier defects due to FLG mutations may play a crucial role in the pathogenesis of atopic dermatitis
18818676 Observational study of gene-disease association. (HuGE Navigator)
18774391 study found no interaction between the SPINK5 eczema risk allele or the putative KLK7 risk allele and FLG mutations
18774391 Observational study of gene-disease association. (HuGE Navigator)
18769192 review of recent advances in understanding of how filaggrin might influence the environmental-immune interface, impacting atopic dermatitis disease penetrance, severity and trajectory [review]
18760831 Filaggrin gene mutations are associated with asthma and eczema in later life
18760831 Observational study of gene-disease association. (HuGE Navigator)
18637008 FLG null alleles are associated with increased susceptibility to CICD; whether or not the FLG null allele is an independent risk factor needs further study.
18637008 Observational study of gene-disease association. (HuGE Navigator)
18620134 Filaggrin plays a key role in epidermal barrier function, and its association with atopic eczema emphasizes the importance of barrier dysfunction in eczema pathogenesis.
18578563 FLG-deficient individuals may need to avoid cats but not dogs in early life to prevent from eczema onset.
18578563 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18565177 Ddystrophic Eepidermolysis Bullosa-Pruriginosa develops as a result of COL7A1 gene mutations and acquired phenotype-modifying factors. Filaggrin mutations did not contribute to the pruriginous phenotype in the present patient cohort.
18521703 FLG null alleles, not common variants, are associated with atopic dermatitis (AD) development and high immunoglobulin E levels for disease onset and allergic sensitization in AD patients.
18521703 Observational study of gene-disease association. (HuGE Navigator)
18420385 There are two novel filaggrin nonsense mutations in Japanese patients with atopic dermatitis.
18396323 filaggrin mutations are key organ specific factors predominantly affecting the development of eczema and confer significant risks of allergic sensitization and allergic rhinitis as well as asthma in the context of eczema.
18396323 Observational study of gene-disease association. (HuGE Navigator)
18385759 p21, a cyclin-dependent kinase inhibitor downstream of S100/A11, is required for calcium-mediated induction of HBD-3 and filaggrin.
18384254 Review highlights association studies on FLG loss-of-function mutations, atopic and non atopic phenotypes, and the role of filaggrin in epidermal barrier function.
18325573 FLG mutations are strong genetic determinants of eczema, early wheeze, asthma in the context of eczema, and atopic sensitization.
18325573 Observational study of gene-disease association. (HuGE Navigator)
18313126 Filaggrin null mutations are significantly associated with mild-to-moderate atopic eczema in childhood, with a recessive pattern of inheritance.
18313126 Observational study of gene-disease association. (HuGE Navigator)
18307574 there is an association between the presence of FLG null mutations and the risk of asthma exacerbations in asthmatic children and young adults.
18307574 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18305568 Loss-of-function mutations in the filaggrin gene lead to reduced level of natural moisturizing factor in the stratum corneum.
18239616 Unique and recurrent mutations in the filaggrin gene in Singaporean Chinese patients with ichthyosis vulgaris.
18239616 Observational study of gene-disease association. (HuGE Navigator)
18200065 filaggrin mutations cause ichthyosis vulgaris and are significantly associated with atopic dermatitis in Japan
18200065 Observational study of gene-disease association. (HuGE Navigator)
18193244 FLG P478S polymorphism may confer susceptibility to the development of psoriasis among Taiwanese Chinese
18193244 Observational study of gene-disease association. (HuGE Navigator)
18176743 This study evaluated families in Sweden and found an association of the filaggrin gene variants R501X and 2282del4 in the development and severity of atopic eczema.
18176743 Observational study of gene-disease association. (HuGE Navigator)
18172455 filaggrin is not expressed in upper airway or esophageal epithelium and is unlikely to play a role in barrier function at those mucosal surfaces
18094728 filaggrin mutations may have a role in early-onset and persistent atopic eczema
18073125 Observational study of gene-disease association. (HuGE Navigator)
18073125 Filaggrin mutations consistently associated with atopic dermatitis and other allergic phenotypes do not appear to influence either susceptibility to asthma or asthma severity phenotypes.
18068483 REVIEW: mutations provide new data concerning the genetics of atopic asthma as well as intriguing insight into disease mechanisms of systemic allergies involving antigen exposure in skin with defective barrier function
18049447 filaggrin mutations may have a role in allergic contact sensitization to nickel
18032906 Evaluation of allele frequencies suggested R501X and 2282del4 filaggrin mutations do not confer susceptibility to psoriasis and atopic dermatitis in Italian patients.
18007582 R501X and c.3321delA in family with ichthyosis vulgasis complicated by atopic dermatitis
18005116 Filaggrin was not detected, suggesting that the differentiation in keratoacanthoma is not epidermoid.
17989887 Observational study of gene-disease association. (HuGE Navigator)
17989887 Atopic dermatitis was associated with filaggrin variants R510X and 2282del4 in adults and children.
17980411 Meta-analysis of gene-disease association. (HuGE Navigator)
17980411 Meta-analysis of sizes of filaggrin (FLG) effects in family studies underline the importance of a genetically determined epidermal barrier disruption via FLG in atopic eczema.
17970802 Observational study of gene-disease association. (HuGE Navigator)
17704064 Observational study of gene-disease association. (HuGE Navigator)
17704064 loss-of-function mutations in the FLG gene may contribute to the development of humoural autoimmunity, targeting citrullinated determinants in early rheumatoid arthritis
17684752 Propionibacterium acnes extracts increased filaggrin and integrins in epidermal explants and cultured keratinocytes.
17657246 Filaggrin mutations are genetic modifying factors exacerbating X-linked ichthyosis
17581619 Observational study of gene-disease association. (HuGE Navigator)
17581619 When alopecia areata (AA) occurs in conjunction with filaggrin-associated atopic disorder, the clinical presentation of AA may be more severe.
17531295 Observational study of gene-disease association. (HuGE Navigator)
17531295 FLG mutations are associated not only with eczema-associated asthma susceptibility but also with asthma severity independent of eczema status.
17502856 there is a spectrum of both prevalent and rare mutations that collectively have a significant impact on susceptibility to atopic disease
17417636 Two common filaggrin (FLG) null mutations cause ichthyosis vulgaris and predispose to eczema and secondary allergic diseases.
17410197 Observational study of gene-disease association. (HuGE Navigator)
17380114 No association for any of the FLG mutations with chronic plague-type psoriasis
17301831 Results provide further confirmation of the importance of mutations in filaggrin and the skin barrier in atopic dermatitis pathogenesis.
17291859 Observational study of gene-disease association. (HuGE Navigator)
17255953 despite a markedly altered filaggrin expression in psoriatic skin, loss-of-function variants of the FLG gene are neither associated with psoriasis vulgaris nor with psoriatic arthritis
17195011 Compromised profilaggrin production leads to epidermal and allergic disorders and our findings emphasize the need for a detailed investigation of the role deacetylase inhibitors in the maintenance of epidermal homeostasis.
17096018 Filaggrin mutations have a role in early-onset and extrinsic atopic dermatitis
17008875 filaggrin gene mutations predispose for early onset of atopic dermatitis
16990802 Observational study of gene-disease association. (HuGE Navigator)
16990802 filaggrin mutations determine major susceptibility to early-onset atopic dermatitis that persists into adulthood
16815158 Observational study of gene-disease association. (HuGE Navigator)
16810297 new mutation, 3702delG, in addition to further instances of the reported mutations R501X and 2282del4
16570058 role of loss of function mutation as reisk factors for atopic dermatitis and asthma
16550169 two independent loss-of-function genetic variants (R510X and 2282del4) in the gene encoding filaggrin (FLG) are very strong predisposing factors for atopic dermatitis
16261374 Observational study of gene-disease association. (HuGE Navigator)
16261374 inverse association between the 12 repeat allele and self-perceived frequent dry skin (P=0.0293)
15675958 PAD1 and 3 are able to modify filaggrin

AA Sequence

MSTLLENIFAIINLFKQYSKKDKNTDTLSKKELKELLEKEFRQILKNPDDPDMVDVFMDHLDIDHNKKID      1 - 70
FTEFLLMVFKLAQAYYESTRKENLPISGHKHRKHSHHDKHEDNKQEENKENRKRPSSLERRNNRKGNKGR     71 - 140
SKSPRETGGKRHESSSEKKERKGYSPTHREEEYGKNHHNSSKKEKNKTENTRLGDNRKRLSERLEEKEDN    141 - 210
EEGVYDYENTGRMTQKWIQSGHIATYYTIQDEAYDTTDSLLEENKIYERSRSSDGKSSSQVNRSRHENTS    211 - 280
QVPLQESRTRKRRGSRVSQDRDSEGHSEDSERHSGSASRNHHGSAWEQSRDGSRHPRSHDEDRASHGHSA    281 - 350
DSSRQSGTRHAETSSRGQTASSHEQARSSPGERHGSGHQQSADSSRHSATGRGQASSAVSDRGHRGSSGS    351 - 420
QASDSEGHSENSDTQSVSGHGKAGLRQQSHQESTRGRSGERSGRSGSSLYQVSTHEQPDSAHGRTGTSTG    421 - 490
GRQGSHHEQARDSSRHSASQEGQDTIRGHPGSSRGGRQGSHHEQSVNRSGHSGSHHSHTTSQGRSDASHG    491 - 560
QSGSRSASRQTRNEEQSGDGTRHSGSRHHEASSQADSSRHSQVGQGQSSGPRTSRNQGSSVSQDSDSQGH    561 - 630
SEDSERWSGSASRNHHGSAQEQSRDGSRHPRSHHEDRAGHGHSADSSRKSGTRHTQNSSSGQAASSHEQA    631 - 700
RSSAGERHGSRHQLQSADSSRHSGTGHGQASSAVRDSGHRGSSGSQATDSEGHSEDSDTQSVSGHGQAGH    701 - 770
HQQSHQESARDRSGERSRRSGSFLYQVSTHKQSESSHGWTGPSTGVRQGSHHEQARDNSRHSASQDGQDT    771 - 840
IRGHPGSSRRGRQGSHHEQSVDRSGHSGSHHSHTTSQGRSDASRGQSGSRSASRTTRNEEQSRDGSRHSG    841 - 910
SRHHEASSHADISRHSQAGQGQSEGSRTSRRQGSSVSQDSDSEGHSEDSERWSGSASRNHRGSAQEQSRH    911 - 980
GSRHPRSHHEDRAGHGHSADSSRQSGTPHAETSSGGQAASSHEQARSSPGERHGSRHQQSADSSRHSGIP    981 - 1050
RRQASSAVRDSGHWGSSGSQASDSEGHSEESDTQSVSGHGQDGPHQQSHQESARDWSGGRSGRSGSFIYQ   1051 - 1120
VSTHEQSESAHGRTRTSTGRRQGSHHEQARDSSRHSASQEGQDTIRAHPGSRRGGRQGSHHEQSVDRSGH   1121 - 1190
SGSHHSHTTSQGRSDASHGQSGSRSASRQTRKDKQSGDGSRHSGSRHHEAASWADSSRHSQVGQEQSSGS   1191 - 1260
RTSRHQGSSVSQDSDSERHSDDSERLSGSASRNHHGSSREQSRDGSRHPGFHQEDRASHGHSADSSRQSG   1261 - 1330
THHTESSSHGQAVSSHEQARSSPGERHGSRHQQSADSSRHSGIGHRQASSAVRDSGHRGSSGSQVTNSEG   1331 - 1400
HSEDSDTQSVSAHGQAGPHQQSHKESARGQSGESSGRSRSFLYQVSSHEQSESTHGQTAPSTGGRQGSRH   1401 - 1470
EQARNSSRHSASQDGQDTIRGHPGSSRGGRQGSYHEQSVDRSGHSGYHHSHTTPQGRSDASHGQSGPRSA   1471 - 1540
SRQTRNEEQSGDGSRHSGSRHHEPSTRAGSSRHSQVGQGESAGSKTSRRQGSSVSQDRDSEGHSEDSERR   1541 - 1610
SESASRNHYGSAREQSRHGSRNPRSHQEDRASHGHSAESSRQSGTRHAETSSGGQAASSQEQARSSPGER   1611 - 1680
HGSRHQQSADSSTDSGTGRRQDSSVVGDSGNRGSSGSQASDSEGHSEESDTQSVSAHGQAGPHQQSHQES   1681 - 1750
TRGQSGERSGRSGSFLYQVSTHEQSESAHGRTGPSTGGRQRSRHEQARDSSRHSASQEGQDTIRGHPGSS   1751 - 1820
RGGRQGSHYEQSVDSSGHSGSHHSHTTSQERSDVSRGQSGSRSVSRQTRNEKQSGDGSRHSGSRHHEASS   1821 - 1890
RADSSRHSQVGQGQSSGPRTSRNQGSSVSQDSDSQGHSEDSERWSGSASRNHLGSAWEQSRDGSRHPGSH   1891 - 1960
HEDRAGHGHSADSSRQSGTRHTESSSRGQAASSHEQARSSAGERHGSHHQLQSADSSRHSGIGHGQASSA   1961 - 2030
VRDSGHRGYSGSQASDSEGHSEDSDTQSVSAQGKAGPHQQSHKESARGQSGESSGRSGSFLYQVSTHEQS   2031 - 2100
ESTHGQSAPSTGGRQGSHYDQAQDSSRHSASQEGQDTIRGHPGPSRGGRQGSHQEQSVDRSGHSGSHHSH   2101 - 2170
TTSQGRSDASRGQSGSRSASRKTYDKEQSGDGSRHSGSHHHEASSWADSSRHSLVGQGQSSGPRTSRPRG   2171 - 2240
SSVSQDSDSEGHSEDSERRSGSASRNHHGSAQEQSRDGSRHPRSHHEDRAGHGHSAESSRQSGTHHAENS   2241 - 2310
SGGQAASSHEQARSSAGERHGSHHQQSADSSRHSGIGHGQASSAVRDSGHRGSSGSQASDSEGHSEDSDT   2311 - 2380
QSVSAHGQAGPHQQSHQESTRGRSAGRSGRSGSFLYQVSTHEQSESAHGRTGTSTGGRQGSHHKQARDSS   2381 - 2450
RHSTSQEGQDTIHGHPGSSSGGRQGSHYEQLVDRSGHSGSHHSHTTSQGRSDASHGHSGSRSASRQTRND   2451 - 2520
EQSGDGSRHSGSRHHEASSRADSSGHSQVGQGQSEGPRTSRNWGSSFSQDSDSQGHSEDSERWSGSASRN   2521 - 2590
HHGSAQEQLRDGSRHPRSHQEDRAGHGHSADSSRQSGTRHTQTSSGGQAASSHEQARSSAGERHGSHHQQ   2591 - 2660
SADSSRHSGIGHGQASSAVRDSGHRGYSGSQASDNEGHSEDSDTQSVSAHGQAGSHQQSHQESARGRSGE   2661 - 2730
TSGHSGSFLYQVSTHEQSESSHGWTGPSTRGRQGSRHEQAQDSSRHSASQDGQDTIRGHPGSSRGGRQGY   2731 - 2800
HHEHSVDSSGHSGSHHSHTTSQGRSDASRGQSGSRSASRTTRNEEQSGDGSRHSGSRHHEASTHADISRH   2801 - 2870
SQAVQGQSEGSRRSRRQGSSVSQDSDSEGHSEDSERWSGSASRNHHGSAQEQLRDGSRHPRSHQEDRAGH   2871 - 2940
GHSADSSRQSGTRHTQTSSGGQAASSHEQARSSAGERHGSHHQQSADSSRHSGIGHGQASSAVRDSGHRG   2941 - 3010
YSGSQASDNEGHSEDSDTQSVSAHGQAGSHQQSHQESARGRSGETSGHSGSFLYQVSTHEQSESSHGWTG   3011 - 3080
PSTRGRQGSRHEQAQDSSRHSASQYGQDTIRGHPGSSRGGRQGYHHEHSVDSSGHSGSHHSHTTSQGRSD   3081 - 3150
ASRGQSGSRSASRTTRNEEQSGDSSRHSVSRHHEASTHADISRHSQAVQGQSEGSRRSRRQGSSVSQDSD   3151 - 3220
SEGHSEDSERWSGSASRNHRGSVQEQSRHGSRHPRSHHEDRAGHGHSADRSRQSGTRHAETSSGGQAASS   3221 - 3290
HEQARSSPGERHGSRHQQSADSSRHSGIPRGQASSAVRDSRHWGSSGSQASDSEGHSEESDTQSVSGHGQ   3291 - 3360
AGPHQQSHQESARDRSGGRSGRSGSFLYQVSTHEQSESAHGRTRTSTGRRQGSHHEQARDSSRHSASQEG   3361 - 3430
QDTIRGHPGSSRRGRQGSHYEQSVDRSGHSGSHHSHTTSQGRSDASRGQSGSRSASRQTRNDEQSGDGSR   3431 - 3500
HSWSHHHEASTQADSSRHSQSGQGQSAGPRTSRNQGSSVSQDSDSQGHSEDSERWSGSASRNHRGSAQEQ   3501 - 3570
SRDGSRHPTSHHEDRAGHGHSAESSRQSGTHHAENSSGGQAASSHEQARSSAGERHGSHHQQSADSSRHS   3571 - 3640
GIGHGQASSAVRDSGHRGSSGSQASDSEGHSEDSDTQSVSAHGQAGPHQQSHQESTRGRSAGRSGRSGSF   3641 - 3710
LYQVSTHEQSESAHGRAGPSTGGRQGSRHEQARDSSRHSASQEGQDTIRGHPGSRRGGRQGSYHEQSVDR   3711 - 3780
SGHSGSHHSHTTSQGRSDASHGQSGSRSASRETRNEEQSGDGSRHSGSRHHEASTQADSSRHSQSGQGES   3781 - 3850
AGSRRSRRQGSSVSQDSDSEAYPEDSERRSESASRNHHGSSREQSRDGSRHPGSSHRDTASHVQSSPVQS   3851 - 3920
DSSTAKEHGHFSSLSQDSAYHSGIQSRGSPHSSSSYHYQSEGTERQKGQSGLVWRHGSYGSADYDYGESG   3921 - 3990
FRHSQHGSVSYNSNPVVFKERSDICKASAFGKDHPRYYATYINKDPGLCGHSSDISKQLGFSQSQRYYYY   3991 - 4060
E//

Text Mined References (274)

PMID Year Title
27012026 2016 Filaggrin Polymorphism Pro478Ser Is Associated With the Severity of Atopic Dermatitis and Colonization by Staphylococcal aureus.
26830116 2016 Filaggrin genotype does not determine the skin's threshold to UV-induced erythema.
26472199 2015 Stimulation of PPAR? normalizes the skin lipid ratio and improves the skin barrier of normal and filaggrin deficient reconstructed skin.
26381575 2015 Knockdown of either filaggrin or loricrin increases the productions of interleukin (IL)-1?, IL-8, IL-18 and granulocyte macrophage colony-stimulating factor in stratified human keratinocytes.
26282804 2015 FLG (filaggrin) null mutations and sunlight exposure: Evidence of a correlation.
26071937 2015 Filaggrin breakdown products determine corneocyte conformation in patients with atopic dermatitis.
26026341 2015 Thymic stromal lymphopoietin downregulates filaggrin expression by signal transducer and activator of transcription 3 (STAT3) and extracellular signal-regulated kinase (ERK) phosphorylation in keratinocytes.
25946035 2015 Human Basal Tear Peptidome Characterization by CID, HCD, and ETD Followed by in Silico and in Vitro Analyses for Antimicrobial Peptide Identification.
25863977 2015 IL-33 impacts on the skin barrier by downregulating the expression of filaggrin.
25816564 2014 Antioxidant Houttuynia cordata extract upregulates filaggrin expression in an aryl hydrocarbon-dependent manner.
25776938 2015 Explant cultures of atopic dermatitis biopsies maintain their epidermal characteristics in vitro.
25757221 2015 Maternal filaggrin mutations increase the risk of atopic dermatitis in children: an effect independent of mutation inheritance.
25747786 2015 Association of common filaggrin null mutations with atopy but not chronic rhinosinusitis.
25734812 2015 Loss-of-Function Mutations in the Gene Encoding Filaggrin Are Not Strongly Associated with Chronic Actinic Dermatitis.
25712346 2015 Xerosis is associated with asthma in men independent of atopic dermatitis and filaggrin gene mutations.
25678087 2015 Filaggrin gene mutations are not associated with food and aeroallergen sensitization without concomitant atopic dermatitis in adults.
25660180 2015 Sebaceous gland, hair shaft, and epidermal barrier abnormalities in keratosis pilaris with and without filaggrin deficiency.
25659224 2015 Anatomical patterns of dermatitis in adult filaggrin mutation carriers.
25620092 2015 Loss-of-function variants of the filaggrin gene are associated with clinical reactivity to foods.
25581911 2015 Skin reaction and regeneration after single sodium lauryl sulfate exposure stratified by filaggrin genotype and atopic dermatitis phenotype.
25580797 2014 What is new and hot in genetics of human atopic dermatitis: shifting paradigms in the landscape of allergic skin diseases.
25564772 2015 Low filaggrin monomer repeats in African American pediatric patients with moderate to severe atopic dermatitis.
25528737 2015 FLG P478S polymorphisms and environmental risk factors for the atopic march in Taiwanese children: a prospective cohort study.
25390410 2014 Filaggrin mutations in a Western siberian population and their association with atopic dermatitis in children.
25383447 2015 Common filaggrin gene mutations and risk of cervical cancer.
25314673 2015 Filaggrin loss-of-function mutations are not associated with atopic dermatitis that develops in late childhood or adulthood.
25282568 2014 Peanut allergy: effect of environmental peanut exposure in children with filaggrin loss-of-function mutations.
25277085 2014 Association of filaggrin variants with asthma and rhinitis: is eczema or allergic sensitization status an effect modifier?
25230061 2014 Filaggrin single nucleotide polymorphisms in atopic dermatitis.
25174864 2014 Filaggrin loss-of-function mutations are associated with food allergy in childhood and adolescence.
25086748 2014 Filaggrin loss-of-function mutations are not a predisposing factor for atopic dermatitis in an Ishigaki Island under subtropical climate.
25065719 2014 Causes of epidermal filaggrin reduction and their role in the pathogenesis of atopic dermatitis.
24940654 2014 Knockdown of filaggrin in a three-dimensional reconstructed human epidermis impairs keratinocyte differentiation.
24920311 Filaggrin gene mutations in African Americans with both ichthyosis vulgaris and atopic dermatitis.
24912553 2014 Methylation of the filaggrin gene promoter does not affect gene expression and allergy.
24905740 2014 Associations of filaggrin gene loss-of-function variants and human papillomavirus-related cancer and pre-cancer in Danish adults.
24880632 2014 Filaggrin-stratified transcriptomic analysis of pediatric skin identifies mechanistic pathways in patients with atopic dermatitis.
24858702 2014 Filaggrin gene mutation c.3321delA is associated with various clinical features of atopic dermatitis in the Chinese Han population.
24819286 Skin pH, atopic dermatitis, and filaggrin mutations.
24813994 2014 Expression of filaggrin-2 protein in the epidermis of human skin diseases: a comparative analysis with filaggrin.
24726196 2014 Increased epidermal filaggrin in chronic idiopathic urticaria is associated with severity of urticaria.
24708301 2014 Allergic sensitization and filaggrin variants predispose to the comorbidity of eczema, asthma, and rhinitis: results from the Isle of Wight birth cohort.
24629053 2015 Loss-of-function mutations in the gene encoding filaggrin underlie a Japanese family with food-dependent exercise-induced anaphylaxis.
24628370 2014 Filaggrin loss-of-function mutations and incident cancer: a population-based study.
24565632 Increased compound heterozygous filaggrin mutations in severe atopic dermatitis in the United States.
24521637 2013 Association between P478S polymorphism of the filaggrin gene & atopic dermatitis.
24401911 2014 Thymic stromal lymphopoietin variation, filaggrin loss of function, and the persistence of atopic dermatitis.
24369804 2014 South African amaXhosa patients with atopic dermatitis have decreased levels of filaggrin breakdown products but no loss-of-function mutations in filaggrin.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24251354 2014 Severe skin inflammation and filaggrin mutation similarly alter the skin barrier in patients with atopic dermatitis.
24247645 2014 Analysis of filaggrin mutations and expression in corneal specimens from patients with or without atopic dermatitis.
24157460 2014 Filaggrin is a predominant member of the denaturation-resistant nickel-binding proteome of human epidermis.
24111531 2014 Increased efficacy of omalizumab in atopic dermatitis patients with wild-type filaggrin status and higher serum levels of phosphatidylcholines.
24102300 2014 Filaggrin loss-of-function mutations and atopic dermatitis as risk factors for hand eczema in apprentice nurses: part II of a prospective cohort study.
24061166 2014 Filaggrin deficiency leads to impaired lipid profile and altered acidification pathways in a 3D skin construct.
24054371 2013 A familial study of filaggrin mutation in atopic dermatitis.
23947670 2013 Filaggrin compound heterozygous patients carry mutations in trans position.
23927042 2013 Filaggrin gene mutations and risk of basal cell carcinoma.
23886662 2013 A genome-wide association study of atopic dermatitis identifies loci with overlapping effects on asthma and psoriasis.
23867897 2014 Atopic dermatitis and disease severity are the main risk factors for food sensitization in exclusively breastfed infants.
23848345 2014 No remarkable differences in rates of sensitization to common type I and IV allergens between FLG loss-of-function mutation carriers and wild-type subjects.
23744309 2013 [Mutation analysis of FLG gene in 10 Chinese families with ichthyosis vulgaris].
23684069 2013 Filaggrin gene mutation associations with peanut allergy persist despite variations in peanut allergy diagnostic criteria or asthma status.
23657503 2013 IL-25 enhances HSV-1 replication by inhibiting filaggrin expression, and acts synergistically with Th2 cytokines to enhance HSV-1 replication.
23645350 2013 Expression of caspase 14 and filaggrin in oral squamous carcinoma.
23629652 2013 Kallikrein-related peptidase 5 functions in proteolytic processing of profilaggrin in cultured human keratinocytes.
23622014 2013 Food sensitization in Japanese infants is associated with a common Filaggrin variant.
23601069 2013 Severe occupational protein contact dermatitis caused by fish in 2 patients with filaggrin mutations.
23568457 2013 Genetic variants associated with disordered eating.
23548340 2013 Association between loss-of-function mutations in the filaggrin gene and self-reported food allergy and alcohol sensitivity.
23460889 2013 Vitamin D status, filaggrin genotype, and cardiovascular risk factors: a Mendelian randomization approach.
23421459 2013 Genotype-phenotype associations in filaggrin loss-of-function mutation carriers.
23403047 2013 Defects of filaggrin-like proteins in both lesional and nonlesional atopic skin.
23343419 2013 Filaggrin mutations are strongly associated with contact sensitization in individuals with dermatitis.
23301728 2013 Ichthyosis vulgaris: the filaggrin mutation disease.
23297869 2013 Complete filaggrin deficiency in ichthyosis vulgaris is associated with only moderate changes in epidermal permeability barrier function profile.
23290076 2013 Analyses of FLG mutation frequency and filaggrin expression in isolated ichthyosis vulgaris (IV) and atopic dermatitis-associated IV.
23273645 2013 Impaired tight junctions obstruct stratum corneum formation by altering polar lipid and profilaggrin processing.
23166590 2012 Clinical presentation of atopic dermatitis by filaggrin gene mutation status during the first 7 years of life in a prospective cohort study.
23154627 2012 Heritable filaggrin disorders: the paradigm of atopic dermatitis.
23152869 2012 Common FLG mutation K4671X not associated with atopic dermatitis in Han Chinese in a family association study.
23078034 2013 Low frequency of filaggrin null mutations in Croatia and their relation with allergic diseases.
23063684 2012 Cholesterol sulfate induces expression of the skin barrier protein filaggrin in normal human epidermal keratinocytes through induction of ROR?.
23039796 2013 Impact of atopic dermatitis and loss-of-function mutations in the filaggrin gene on the development of occupational irritant contact dermatitis.
22989708 Predictors of atopic dermatitis phenotypes and severity: roles of serum immunoglobulins and filaggrin gene mutation R501X.
22964107 2012 Filaggrin loss-of-function mutations do not predict food allergy over and above the risk of food sensitization among infants.
22962861 2012 Clinical course of occupational irritant contact dermatitis of the hands in relation to filaggrin genotype status and atopy.
22960809 Filaggrin mutations and the skin.
22951058 2012 The persistence of atopic dermatitis and filaggrin (FLG) mutations in a US longitudinal cohort.
22921868 2012 Skin barrier abnormality caused by filaggrin (FLG) mutations is associated with increased serum 25-hydroxyvitamin D concentrations.
22903496 2012 Interactions between FLG mutations and allergens in atopic dermatitis.
22897780 2012 The hands in health and disease of individuals with filaggrin loss-of-function mutations: clinical reflections on the hand eczema phenotype.
22742591 2012 The antimicrobial peptide pheromone Plantaricin A increases antioxidant defenses of human keratinocytes and modulates the expression of filaggrin, involucrin, ?-defensin 2 and tumor necrosis factor-? genes.
22635822 2012 Filaggrin mutations are not associated with chronic allergic keratoconjunctivitis.
22622429 2012 Regulatory role for the profilaggrin N-terminal domain in epidermal homeostasis.
22612618 2012 Usefulness of a global clinical ichthyosis vulgaris scoring system for predicting common FLG null mutations in an adult caucasian population.
22418870 2012 Interactions between genetic variants of FLG and chromosome 11q13 locus determine susceptibility for eczema phenotypes.
22407025 2012 Loss-of-function mutations in filaggrin gene associate with psoriasis vulgaris in Chinese population.
22403702 2012 Interplay of filaggrin loss-of-function variants, allergic sensitization, and eczema in a longitudinal study covering infancy to 18 years of age.
22381027 2012 Atopic diseases by filaggrin mutations and birth year.
22360978 2012 Filaggrin mutations increase the risk for persistent dry skin and eczema independent of sensitization.
22322004 2012 Filaggrin loss-of-function mutations are associated with enhanced expression of IL-1 cytokines in the stratum corneum of patients with atopic dermatitis and in a murine model of filaggrin deficiency.
22299762 2012 Novel FLG mutations associated with ichthyosis vulgaris in the Chinese population.
22288457 2012 Filaggrin mutations and atopy: consequences for future therapeutics.
22229441 2012 IL-17 downregulates filaggrin and affects keratinocyte expression of genes associated with cellular adhesion.
22220561 2013 Mutations analysis in filaggrin gene in northern China patients with atopic dermatitis.
22182180 2013 Lack of association between filaggrin gene mutations and onset of psoriasis in childhood.
22177328 2012 IL-31 regulates differentiation and filaggrin expression in human organotypic skin models.
22158554 2012 One remarkable molecule: filaggrin.
22088612 2012 Interaction between filaggrin null mutations and tobacco smoking in relation to asthma.
22071473 2012 Intragenic copy number variation within filaggrin contributes to the risk of atopic dermatitis with a dose-dependent effect.
22030464 2011 Predictive value of food sensitization and filaggrin mutations in children with eczema.
21999178 2011 Filaggrin in atopic dermatitis: flaky tail mice as a novel model for developing drug targets in atopic dermatitis.
21991953 2011 Filaggrin mutations associated with skin and allergic diseases.
21983738 2011 [Association of filaggrin gene polymorphism with atopic dermatitis in southern Chinese Han population].
21945601 2011 Exacerbation of X-linked ichthyosis phenotype in a female by inheritance of filaggrin and steroid sulfatase mutations.
21923691 2013 Association between filaggrin mutations and atopic dermatitis in Korean pregnant women.
21923666 2011 Filaggrin gene mutations are associated with independent atopic asthma in Chinese patients.
21790526 2012 Filaggrin mutations are associated with recurrent skin infection in Singaporean Chinese patients with atopic dermatitis.
21777221 2012 Filaggrin loss-of-function mutation R501X and 2282del4 carrier status is associated with fissured skin on the hands: results from a cross-sectional population study.
21723775 2011 Chronic exposure to cigarette smoke increases matrix metalloproteinases and Filaggrin mRNA expression in oral keratinocytes: role of nicotine stimulation.
21701148 2011 A prospective study of filaggrin null mutations in keratoconus patients with or without atopic disorders.
21692775 2011 Novel filaggrin mutation but no other loss-of-function variants found in Ethiopian patients with atopic dermatitis.
21666691 2011 Genome-wide association study identifies two new susceptibility loci for atopic dermatitis in the Chinese Han population.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21576945 2011 Loss-of-function mutations within the filaggrin gene and atopic dermatitis.
21531719 2011 Deimination of human filaggrin-2 promotes its proteolysis by calpain 1.
21518425 2011 Genetics of atopic dermatitis.
21514438 2011 Filaggrin genotype in ichthyosis vulgaris predicts abnormalities in epidermal structure and function.
21501248 2012 Individuals who are homozygous for the 2282del4 and R501X filaggrin null mutations do not always develop dermatitis and complete long-term remission is possible.
21496060 2011 Associations of FLG mutations between ichthyosis vulgaris and atopic dermatitis in Han Chinese.
21434976 2011 Association between filaggrin null mutations and concomitant atopic dermatitis and contact allergy.
21426411 2011 Combined occurrence of filaggrin mutations and IL-10 or IL-13 polymorphisms predisposes to atopic dermatitis.
21410766 2011 Distinct barrier integrity phenotypes in filaggrin-related atopic eczema following sequential tape stripping and lipid profiling.
21365004 2011 Filaggrin gene defects are independent risk factors for atopic asthma in a Polish population: a study in ECAP cohort.
21326297 2011 Filaggrin null mutations are not a protective factor for acne vulgaris.
21289640 2011 Full sequencing of the FLG gene in Italian patients with atopic eczema: evidence of new mutations, but lack of an association.
21261659 2011 Levels of filaggrin degradation products are influenced by both filaggrin genotype and atopic dermatitis severity.
21255094 2011 Filaggrin knockdown and Toll-like receptor 3 (TLR3) stimulation enhanced the production of thymic stromal lymphopoietin (TSLP) from epidermal layers.
21219289 2011 Filaggrin polymorphism P478S, IgE level, and atopic phenotypes.
21166815 2011 Nickel reactivity and filaggrin null mutations--evaluation of the filaggrin bypass theory in a general population.
21137118 2010 Filaggrin loss-of-function mutations are associated with early-onset eczema, eczema severity and transepidermal water loss at 3 months of age.
21074596 2011 Latex allergy and filaggrin null mutations.
21039602 2011 Mutations in the filaggrin gene in Han Chinese patients with atopic dermatitis.
20975288 2011 Common filaggrin null alleles are not associated with hymenoptera venom allergy in Europeans.
20962854 2011 Skin barrier function in healthy subjects and patients with atopic dermatitis in relation to filaggrin loss-of-function mutations.
20943104 2010 Molecular studies of ichthyosis vulgaris in Pakistani families.
20865458 2010 Lower prevalence of common filaggrin mutations in a community sample of atopic eczema: is disease severity important?
20814636 2010 Filaggrin null-mutations may be associated with a distinct subtype of atopic hand eczema.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20686498 2010 Japanese-specific filaggrin gene mutations in Japanese patients suffering from atopic eczema and asthma.
20629673 2010 Filaggrin null mutations and association with contact allergy and allergic contact dermatitis: results from a tertiary dermatology clinic.
20621340 2010 Raman profiles of the stratum corneum define 3 filaggrin genotype-determined atopic dermatitis endophenotypes.
20573035 2010 Filaggrin gene variants and atopic diseases in early childhood assessed longitudinally from birth.
20513523 2010 Elder siblings enhance the effect of filaggrin mutations on childhood eczema: results from the 2 birth cohort studies LISAplus and GINIplus.
20500796 2010 Filaggrin null mutations associate with increased frequencies of allergen-specific CD4+ T-helper 2 cells in patients with atopic eczema.
20445547 2010 Knockdown of filaggrin impairs diffusion barrier function and increases UV sensitivity in a human skin model.
20426775 2010 Filaggrin null mutations increase the risk and persistence of hand eczema in subjects with atopic dermatitis: results from a general population study.
20346018 2010 The association between null mutations in the filaggrin gene and contact sensitization to nickel and other chemicals in the general population.
20230798 2010 Sphingosylphosphorylcholine down-regulates filaggrin gene transcription through NOX5-based NADPH oxidase and cyclooxygenase-2 in human keratinocytes.
20222934 2010 Novel and recurrent mutations in the filaggrin gene in Chinese patients with ichthyosis vulgaris.
20208004 2010 Coordinate interaction between IL-13 and epithelial differentiation cluster genes in eosinophilic esophagitis.
20179351 2010 Elastase 2 is expressed in human and mouse epidermis and impairs skin barrier function in Netherton syndrome through filaggrin and lipid misprocessing.
20159264 2010 S2554X mutation in the filaggrin gene is associated with allergen sensitization in the Japanese population.
20149601 2010 Evidence for genetic modifiers other than filaggrin mutations in X-linked ichthyosis.
20132155 2010 Stratum corneum lipids, skin barrier function and filaggrin mutations in patients with atopic eczema.
20109745 2010 Chromosome 11q13.5 variant associated with childhood eczema: an effect supplementary to filaggrin mutations.
20028371 2010 Analysis of the high affinity IgE receptor genes reveals epistatic effects of FCER1A variants on eczema risk.
20016199 2010 Human leukocyte antigen (DR1)-DQB1*0501 and (DR15)-DQB1*0602 haplotypes are associated with humoral responses to early food allergens in children.
19958351 2010 FLG mutations in ichthyosis vulgaris and atopic eczema: spectrum of mutations and population genetics.
19874431 2010 Analysis of four prevalent filaggrin mutations (R501X, 2282del4, R2447X and S3247X) in Austrian and German patients with atopic dermatitis.
19863505 2010 Association analysis of filaggrin gene mutations and atopic dermatitis in Northern China.
19839980 2009 Filaggrin mutations in the onset of eczema, sensitization, asthma, hay fever and the interaction with cat exposure.
19804695 Meta-analysis of genome-wide linkage studies of atopic dermatitis.
19785597 2009 Increased pachyonychia congenita severity in patients with concurrent keratin and filaggrin mutations.
19733298 2009 Filaggrin mutations that confer risk of atopic dermatitis confer greater risk for eczema herpeticum.
19720210 2009 Cytokine modulation of atopic dermatitis filaggrin skin expression.
19681860 2009 Filaggrin haploinsufficiency is highly penetrant and is associated with increased severity of eczema: further delineation of the skin phenotype in a prospective epidemiological study of 792 school children.
19663875 2009 FLG mutation p.Lys4021X in the C-terminal imperfect filaggrin repeat in Japanese patients with atopic eczema.
19602001 2009 Filaggrin null mutations in childhood atopic dermatitis among the Chinese.
19601998 2009 Variation in genes of the epidermal differentiation complex in German atopic dermatitis patients.
19601982 2010 MAP17 is associated with the T-helper cell cytokine-induced down-regulation of filaggrin transcription in human keratinocytes.
19589816 2009 Filaggrin gene defects and risk of developing allergic sensitisation and allergic disorders: systematic review and meta-analysis.
19550302 2009 Abnormal skin barrier in the etiopathogenesis of atopic dermatitis.
19538357 2009 Association of Filaggrin loss-of-function-mutations with atopic dermatitis and asthma in the Early Treatment of the Atopic Child (ETAC) population.
19538184 2009 Filaggrin mutations may confer susceptibility to chronic hand eczema characterized by combined allergic and irritant contact dermatitis.
19515043 2009 Comparative analysis of the expression of cytokeratins (1, 10, 14, 16, 4), involucrin, filaggrin and e-cadherin in plane warts and epidermodysplasia verruciformis plane wart-type lesions.
19501237 2009 Meta-analysis of filaggrin polymorphisms in eczema and asthma: robust risk factors in atopic disease.
19492053 2009 Carrier status for the common R501X and 2282del4 filaggrin mutations is not associated with hearing phenotypes in 5,377 children from the ALSPAC cohort.
19408338 2009 Filaggrin loss-of-function variants are associated with atopic comorbidity in pediatric inflammatory bowel disease.
19384417 2009 Molecular identification and expression analysis of filaggrin-2, a member of the S100 fused-type protein family.
19348926 2009 An interaction between filaggrin mutations and early food sensitization improves the prediction of childhood asthma.
19247692 2009 Analyses of associations with asthma in four asthma population samples from Canada and Australia.
19239468 2009 Filaggrin mutations are associated with ichthyosis vulgaris in the Bangladeshi population.
19183181 2009 Ichthyosis vulgaris: novel FLG mutations in the German population and high presence of CD1a+ cells in the epidermis of the atopic subgroup.
19134432 Nickel sensitization, hand eczema, and loss-of-function mutations in the filaggrin gene.
19037238 2009 Prevalent and rare mutations in the gene encoding filaggrin in Japanese patients with ichthyosis vulgaris and atopic dermatitis.
18987673 2009 Heterozygous null alleles in filaggrin contribute to clinical dry skin in young adults and the elderly.
18976374 2008 Classification of atopic hand eczema and the filaggrin mutations.
18843291 2009 Ichthyosis, follicular atrophoderma, and hypotrichosis caused by mutations in ST14 is associated with impaired profilaggrin processing.
18818676 2009 Clinical severity correlates with impaired barrier in filaggrin-related eczema.
18774391 2008 Analysis of the individual and aggregate genetic contributions of previously identified serine peptidase inhibitor Kazal type 5 (SPINK5), kallikrein-related peptidase 7 (KLK7), and filaggrin (FLG) polymorphisms to eczema risk.
18769192 2008 The role of filaggrin loss-of-function mutations in atopic dermatitis.
18760831 2008 Filaggrin gene mutations are associated with asthma and eczema in later life.
18637008 2008 Loss-of-function polymorphisms in the filaggrin gene are associated with an increased susceptibility to chronic irritant contact dermatitis: a case-control study.
18620134 2008 Atopic eczema and the filaggrin story.
18578563 2008 Gene-environment interaction in the onset of eczema in infancy: filaggrin loss-of-function mutations enhanced by neonatal cat exposure.
18565177 2008 Dystrophic epidermolysis bullosa pruriginosa is not associated with frequent FLG gene mutations.
18521703 2008 Filaggrin null mutations are associated with atopic dermatitis and elevated levels of IgE in the Japanese population: a family and case-control study.
18420385 2008 Sequence analysis of filaggrin gene by novel shotgun method in Japanese atopic dermatitis.
18396323 2008 Filaggrin mutations, atopic eczema, hay fever, and asthma in children.
18385759 2008 Th2 cytokines act on S100/A11 to downregulate keratinocyte differentiation.
18384254 2008 Filaggrin loss-of-function mutations and association with allergic diseases.
18325573 2008 The burden of disease associated with filaggrin mutations: a population-based, longitudinal birth cohort study.
18313126 2008 Filaggrin null mutations and childhood atopic eczema: a population-based case-control study.
18307574 2008 Filaggrin null mutations are associated with increased asthma exacerbations in children and young adults.
18305568 2008 Loss-of-function mutations in the filaggrin gene lead to reduced level of natural moisturizing factor in the stratum corneum.
18239616 2008 Unique and recurrent mutations in the filaggrin gene in Singaporean Chinese patients with ichthyosis vulgaris.
18200065 2008 Specific filaggrin mutations cause ichthyosis vulgaris and are significantly associated with atopic dermatitis in Japan.
18193244 2008 Association between P478S polymorphism of the filaggrin gene and risk of psoriasis in a Chinese population in Taiwan.
18176743 2008 Loss-of-function variants of the filaggrin gene are associated with atopic eczema and associated phenotypes in Swedish families.
18172455 2008 Filaggrin expression in oral, nasal, and esophageal mucosa.
18094728 2008 Prevalent and low-frequency null mutations in the filaggrin gene are associated with early-onset and persistent atopic eczema.
18073125 2007 Filaggrin mutations confer susceptibility to atopic dermatitis but not to asthma.
18068483 2008 The filaggrin story: novel insights into skin-barrier function and disease.
18049447 2008 Loss-of-function mutations in the filaggrin gene and allergic contact sensitization to nickel.
18032906 2008 R501X and 2282del4 filaggrin mutations do not confer susceptibility to psoriasis and atopic dermatitis in Italian patients.
18007582 2008 De novo occurrence of the filaggrin mutation p.R501X with prevalent mutation c.3321delA in a Japanese family with ichthyosis vulgaris complicated by atopic dermatitis.
18005116 2008 Keratin and filaggrin expression in keratoacanthoma.
17989887 2007 Analysis of SPINK 5, KLK 7 and FLG genotypes in a French atopic dermatitis cohort.
17980411 2007 Toward a major risk factor for atopic eczema: meta-analysis of filaggrin polymorphism data.
17970802 2007 Filaggrin null alleles are not associated with hand eczema or contact allergy.
17704064 2008 Loss-of-function mutations in the filaggrin gene: no contribution to disease susceptibility, but to autoantibody formation against citrullinated peptides in early rheumatoid arthritis.
17704059 2007 Role of ADAM-9 disintegrin-cysteine-rich domains in human keratinocyte migration.
17684752 2007 Modulation of integrins and filaggrin expression by Propionibacterium acnes extracts on keratinocytes.
17657246 2007 Filaggrin mutations are genetic modifying factors exacerbating X-linked ichthyosis.
17581619 2007 Loss-of-function mutations in the filaggrin gene and alopecia areata: strong risk factor for a severe course of disease in patients comorbid for atopic disease.
17531295 2007 Filaggrin null mutations are associated with increased asthma severity in children and young adults.
17502856 2007 Filaggrin's fuller figure: a glimpse into the genetic architecture of atopic dermatitis.
17417636 2007 Comprehensive analysis of the gene encoding filaggrin uncovers prevalent and rare mutations in ichthyosis vulgaris and atopic eczema.
17410197 2007 Filaggrin null alleles are not associated with psoriasis.
17380114 2007 Filaggrin R501X and 2282del4 mutations are not associated with chronic plaque-type psoriasis in a German cohort.
17301831 2007 Filaggrin mutations in children with severe atopic dermatitis.
17291859 2007 Unique mutations in the filaggrin gene in Japanese patients with ichthyosis vulgaris and atopic dermatitis.
17255953 2007 Loss-of-function variants of the filaggrin gene are not major susceptibility factors for psoriasis vulgaris or psoriatic arthritis in German patients.
17195011 2007 Inhibition of histone deacetylation promotes abnormal epidermal differentiation and specifically suppresses the expression of the late differentiation marker profilaggrin.
17096018 2007 Filaggrin mutations strongly predispose to early-onset and extrinsic atopic dermatitis.
17030239 2006 Filaggrin loss-of-function mutations predispose to phenotypes involved in the atopic march.
17008875 2007 Two common loss-of-function mutations within the filaggrin gene predispose for early onset of atopic dermatitis.
16990802 2007 Null mutations in the filaggrin gene (FLG) determine major susceptibility to early-onset atopic dermatitis that persists into adulthood.
16815158 2006 Loss-of-function variations within the filaggrin gene predispose for atopic dermatitis with allergic sensitizations.
16810297 2006 Prevalent and rare mutations in the gene encoding filaggrin cause ichthyosis vulgaris and predispose individuals to atopic dermatitis.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16570058 2006 Skin barrier function and allergic risk.
16550169 2006 Common loss-of-function variants of the epidermal barrier protein filaggrin are a major predisposing factor for atopic dermatitis.
16444271 2006 Loss-of-function mutations in the gene encoding filaggrin cause ichthyosis vulgaris.
16261374 2005 Filaggrin repeat number polymorphism is associated with a dry skin phenotype.
15675958 2005 Peptidylarginine deiminase isoforms 1-3 are expressed in the epidermis and involved in the deimination of K1 and filaggrin.
12850301 2003 Analysis of epidermal-type transglutaminase (transglutaminase 3) in human stratified epithelia and cultured keratinocytes using monoclonal antibodies.
12838398 2003 Linkage analysis suggests a locus of ichthyosis vulgaris on 1q22.
12230510 2002 Functional analysis of the profilaggrin N-terminal peptide: identification of domains that regulate nuclear and cytoplasmic distribution.
11380615 2001 Proprotein convertase expression and localization in epidermis: evidence for multiple roles and substrates.
11279517 2001 Genetic linkage of childhood atopic dermatitis to psoriasis susceptibility loci.
9886436 1999 The epitopes targeted by the rheumatoid arthritis-associated antifilaggrin autoantibodies are posttranslationally generated on various sites of (pro)filaggrin by deimination of arginine residues.
8780679 1996 Preferential deimination of keratin K1 and filaggrin during the terminal differentiation of human epidermis.
8417356 1993 Profilaggrin is a major epidermal calcium-binding protein.
7612609 1995 Identification of the amino terminus of human filaggrin using differential LC/MS techniques: implications for profilaggrin processing.
6174530 1982 Abnormal epidermal keratinization in the repeated epilation mutant mouse.
4132224 1974 Keratohyalin protein in disorders of keratinization.
2740331 1989 Characterization of a cDNA clone encoding human filaggrin and localization of the gene to chromosome region 1q21.
2579164 1985 Ichthyosis vulgaris: identification of a defect in synthesis of filaggrin correlated with an absence of keratohyaline granules.
2248957 1990 Organization, structure, and polymorphisms of the human profilaggrin gene.
2043621 1991 Organization, structure, and polymorphisms of the human profilaggrin gene.
1429717 1992 Characterization of the human epidermal profilaggrin gene. Genomic organization and identification of an S-100-like calcium binding domain at the amino terminus.