Property Summary

NCBI Gene PubMed Count 19
PubMed Score 28.93
PubTator Score 33.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Breast Neoplasms 445 0.0 0.0
Disease Target Count
Mammary Neoplasms 425
Disease Target Count P-value
malignant mesothelioma 3232 5.0e-06
osteosarcoma 7950 4.7e-05
group 3 medulloblastoma 4104 6.2e-04
psoriasis 6694 6.7e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Vitiligo 73 0.0 3.0

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma 1.100 6.2e-04
malignant mesothelioma 1.100 5.0e-06
osteosarcoma -1.650 4.7e-05
psoriasis 1.300 6.7e-04

Synonym

Accession Q9UIM3 A8K5V3 B0UYX8 Q9H5G3
Symbols NG7
DIR1
FKBP4
WISP39

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (10)

Gene RIF (13)

AA Sequence

METPPVNTIGEKDTSQPQQEWEKNLRENLDSVIQIRQQPRDPPTETLELEVSPDPASQILEHTQGAEKLV      1 - 70
AELEGDSHKSHGSTSQMPEALQASDLWYCPDGSFVKKIVIRGHGLDKPKLGSCCRVLALGFPFGSGPPEG     71 - 140
WTELTMGVGPWREETWGELIEKCLESMCQGEEAELQLPGHSGPPVRLTLASFTQGRDSWELETSEKEALA    141 - 210
REERARGTELFRAGNPEGAARCYGRALRLLLTLPPPGPPERTVLHANLAACQLLLGQPQLAAQSCDRVLE    211 - 280
REPGHLKALYRRGVAQAALGNLEKATADLKKVLAIDPKNRAAQEELGKVVIQGKNQDAGLAQGLRKMFG     281 - 349
//

Text Mined References (24)

PMID Year Title