Property Summary

Ligand Count 17
NCBI Gene PubMed Count 218
PubMed Score 348.09
PubTator Score 220.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Opiate dependence 29 0.0 5.0
Disease Target Count Z-score Confidence
post-traumatic stress disorder 40 6.021 3.0
Cancer 2499 3.207 1.6

Expression

PDB (40)

Gene RIF (199)

AA Sequence

MTTDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSS      1 - 70
HDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE     71 - 140
DLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQ    141 - 210
REEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFK    211 - 280
GGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSAN    281 - 350
EKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQD    351 - 420
AKEEANKAMGKKTSEGVTNEKGTDSQAMEEEKPEGHV                                     421 - 457
//

Text Mined References (229)

PMID Year Title