Property Summary

NCBI Gene PubMed Count 22
PubMed Score 84.61
PubTator Score 35.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
acute quadriplegic myopathy 1157 2.0e-05
ovarian cancer 8491 3.1e-05
lung cancer 4473 1.4e-04
Disease Target Count Z-score Confidence
Spinal stenosis 15 3.505 1.8
Intermittent claudication 16 3.108 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
acute quadriplegic myopathy -1.115 2.0e-05
lung cancer 1.800 1.4e-04
ovarian cancer 2.300 3.1e-05

Synonym

Accession Q00688 B2R4Q9 Q14317 PPIase FKBP3
Symbols FKBP-3
FKBP25
PPIase
FKBP-25

Gene

PANTHER Protein Class (1)

PDB

1PBK   2KFV   2MPH   5D75  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (7)

PMID Text
26762975 Structural basis for nucleic acid recognition by FKBP25 has been uncovered.
24998444 proteomics study indicates that the nuclear pool of the FKBP25 targets various nuclear proteins that are crucial for packaging of DNA, chromatin remodeling and pre-mRNA splicing
24840943 FKBP25 is likely recruited to preribosomes to chaperone one of the protein components of the ribosome large subunit.
24667607 structure of a unique N-terminal domain motif in the FKBP family, FKBP25(1-73), high-resolution structures show a new fold composed of five small helices where H3 and H4 are tilted in a novel arrangement; called Basic Tilted Helix Bundle (BTHB) domain.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19166840 FKBP3, a novel regulator of the p53 pathway, induces the degradation of MDM2 and activation of p53.

AA Sequence

MAAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETK      1 - 70
RFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQ     71 - 140
DGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPP    141 - 210
NAKLTFEVELVDID                                                            211 - 224
//

Text Mined References (33)

PMID Year Title
26762975 2016 Structural basis of nucleic acid recognition by FK506-binding protein 25 (FKBP25), a nuclear immunophilin.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24998444 2014 Rapamycin-binding FKBP25 associates with diverse proteins that form large intracellular entities.
24840943 2014 The prolyl isomerase, FKBP25, interacts with RNA-engaged nucleolin and the pre-60S ribosomal subunit.
24667607 2014 Basic Tilted Helix Bundle - a new protein fold in human FKBP25/FKBP3 and HectD1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21812934 2011 Identification of candidate substrates for poly(ADP-ribose) polymerase-2 (PARP2) in the absence of DNA damage using high-density protein microarrays.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19166840 2009 FKBP25, a novel regulator of the p53 pathway, induces the degradation of MDM2 and activation of p53.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12392168 2002 Cloning and identification of a novel cDNA which may be associated with FKBP25.
11532945 2001 The FK506-binding protein 25 functionally associates with histone deacetylases and with transcription factor YY1.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8012384 1994 Purification of CpG islands using a methylated DNA binding column.
7689229 1993 The 25-kDa FK506-binding protein is localized in the nucleus and associates with casein kinase II and nucleolin.
1532945 1992 Interleukin-1 (IL-1) receptor blockade reduces endotoxin and Borrelia burgdorferi-stimulated IL-8 synthesis in human mononuclear cells.
1376117 1992 Isolation of a human cDNA encoding a 25 kDa FK-506 and rapamycin binding protein.
1375932 1992 Molecular cloning of a 25-kDa high affinity rapamycin binding protein, FKBP25.
1374240 1992 cDNA cloning of a human 25 kDa FK506 and rapamycin binding protein.