Property Summary

Ligand Count 9
NCBI Gene PubMed Count 36
PubMed Score 114.17
PubTator Score 84.76

Knowledge Summary

Patent

No data available

Expression

PDB (31)

Gene RIF (22)

AA Sequence

MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLG      1 - 70
QRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNLE                                     71 - 108
//

Text Mined References (37)

PMID Year Title