Property Summary

NCBI Gene PubMed Count 8
PubMed Score 6.36
PubTator Score 5.41

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
23749938 results suggest a progressively elevated expression of FKBP11 during the development of hepatocellular carcinoma

AA Sequence

MTLRPSLLPLHLLLLLLLSAAVCRAEAGLETESPVRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVD      1 - 70
GRIIDTSLTRDPLVIELGQKQVIPGLEQSLLDMCVGEKRRAIIPSHLAYGKRGFPPSVPADAVVQYDVEL     71 - 140
IALIRANYWLKLVKGILPLVGMAMVPALLGLIGYHLYRKANRPKVSKKKLKEEKRNKSKKK             141 - 201
//

Text Mined References (11)

PMID Year Title
23749938 2013 Identification of FKBP11 as a biomarker for hepatocellular carcinoma.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
16596453 2006 The human FK506-binding proteins: characterization of human FKBP19.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12036304 2002 Genomic organization of mouse and human 65 kDa FK506-binding protein genes and evolution of the FKBP multigene family.