Property Summary

NCBI Gene PubMed Count 30
PubMed Score 44.23
PubTator Score 39.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Astrocytoma, Pilocytic 1.800 2.4e-05
atypical teratoid / rhabdoid tumor 1.600 1.1e-03
glioblastoma 1.400 7.0e-05
lung cancer 1.100 1.1e-03
non-small cell lung cancer 1.093 1.1e-08
osteosarcoma 1.871 1.6e-02
pediatric high grade glioma 1.200 1.4e-03
pituitary cancer -1.200 1.0e-02
posterior fossa group A ependymoma 1.200 6.5e-05
psoriasis -2.800 3.1e-05
sonic hedgehog group medulloblastoma 1.600 1.6e-04

Gene RIF (20)

AA Sequence

MFPAGPPSHSLLRLPLLQLLLLVVQAVGRGLGRASPAGGPLEDVVIERYHIPRACPREVQMGDFVRYHYN      1 - 70
GTFEDGKKFDSSYDRNTLVAIVVGVGRLITGMDRGLMGMCVNERRRLIVPPHLGYGSIGLAGLIPPDATL     71 - 140
YFDVVLLDVWNKEDTVQVSTLLRPPHCPRMVQDGDFVRYHYNGTLLDGTSFDTSYSKGGTYDTYVGSGWL    141 - 210
IKGMDQGLLGMCPGERRKIIIPPFLAYGEKGYGTVIPPQASLVFHVLLIDVHNPKDAVQLETLELPPGCV    211 - 280
RRAGAGDFMRYHYNGSLMDGTLFDSSYSRNHTYNTYIGQGYIIPGMDQGLQGACMGERRRITIPPHLAYG    281 - 350
ENGTGDKIPGSAVLIFNVHVIDFHNPADVVEIRTLSRPSETCNETTKLGDFVRYHYNCSLLDGTQLFTSH    351 - 420
DYGAPQEATLGANKVIEGLDTGLQGMCVGERRQLIVPPHLAHGESGARGVPGSAVLLFEVELVSREDGLP    421 - 490
TGYLFVWHKDPPANLFEDMDLNKDGEVPPEEFSTFIKAQVSEGKGRLMPGQDPEKTIGDMFQNQDRNQDG    491 - 560
KITVDELKLKSDEDEERVHEEL                                                    561 - 582
//

Text Mined References (35)

PMID Year Title