Property Summary

NCBI Gene PubMed Count 5
PubMed Score 9.00
PubTator Score 2.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma 1.400 2.0e-03
astrocytic glioma 1.300 3.6e-03
Astrocytoma, Pilocytic 1.300 2.9e-06
atypical teratoid / rhabdoid tumor 1.500 1.2e-04
Breast cancer 2.900 2.8e-02
colon cancer 2.100 1.3e-03
Endometriosis 1.117 3.3e-02
ependymoma 1.400 2.6e-02
glioblastoma 1.300 1.1e-04
interstitial cystitis 1.200 1.2e-02
intraductal papillary-mucinous adenoma (... -1.200 2.4e-04
intraductal papillary-mucinous neoplasm ... -1.100 1.2e-02
lung cancer 2.500 6.9e-04
medulloblastoma, large-cell 1.100 1.4e-02
nasopharyngeal carcinoma 1.400 2.4e-04
oligodendroglioma 1.800 1.8e-03
ovarian cancer 1.100 5.6e-04
sonic hedgehog group medulloblastoma 1.300 7.8e-06

Gene RIF (1)

AA Sequence

MGRRMRGAAATAGLWLLALGSLLALWGGLLPPRTELPASRPPEDRLPRRPARSGGPAPAPRFPLPPPLAW      1 - 70
DARGGSLKTFRALLTLAAGADGPPRQSRSEPRWHVSARQPRPEESAAVHGGVFWSRGLEEQVPPGFSEAQ     71 - 140
AAAWLEAARGARMVALERGGCGRSSNRLARFADGTRACVRYGINPEQIQGEALSYYLARLLGLQRHVPPL    141 - 210
ALARVEARGAQWAQVQEELRAAHWTEGSVVSLTRWLPNLTDVVVPAPWRSEDGRLRPLRDAGGELANLSQ    211 - 280
AELVDLVQWTDLILFDYLTANFDRLVSNLFSLQWDPRVMQRATSNLHRGPGGALVFLDNEAGLVHGYRVA    281 - 350
GMWDKYNEPLLQSVCVFRERTARRVLELHRGQDAAARLLRLYRRHEPRFPELAALADPHAQLLQRRLDFL    351 - 420
AKHILHCKAKYGRRSGT                                                         421 - 437
//

Text Mined References (7)

PMID Year Title