Property Summary

NCBI Gene PubMed Count 8
PubMed Score 17.25
PubTator Score 19.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

 GWAS Trait (1)

Gene RIF (2)

AA Sequence

MEHLERCEWLLRGTLVRAAVRRYLPWALVASMLAGSLLKELSPLPESYLSNKRNVLNVYFVKVAWAWTFC      1 - 70
LLLPFIALTNYHLTGKAGLVLRRLSTLLVGTAIWYICTSIFSNIEHYTGSCYQSPALEGVRKEHQSKQQC     71 - 140
HQEGGFWHGFDISGHSFLLTFCALMIVEEMSVLHEVKTDRSHCLHTAITTLVVALGILTFIWVLMFLCTA    141 - 210
VYFHNLSQKVFGTLFGLLSWYGTYGFWYPKAFSPGLPPQSCSLNLKQDSYKK                      211 - 262
//

Text Mined References (8)

PMID Year Title