Property Summary

NCBI Gene PubMed Count 52
PubMed Score 129.89
PubTator Score 67.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (5)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.002 1.2e-02
Multiple myeloma 1.653 2.6e-04
medulloblastoma, large-cell -1.400 6.6e-05
Polycystic Ovary Syndrome 1.139 2.0e-02
ovarian cancer 2.100 6.2e-05

 GO Function (1)

Gene RIF (33)

PMID Text
25843291 Study revealed that a novel mitochondrial fission pathway composed of miR-483-5p and FIS1 regulates cisplatin sensitivity.
25822260 Results show that Fis1 is significantly overexpressed in malignant oncocytomas.
24416201 PDCD7, Ang2 and FIS1 may indicate a more aggressive form and poor prognosis of acute myeloid leukemia.
23921378 MiD49 and MiD51 can act independently of Mff and Fis1 in Drp1 recruitment and suggest that they provide specificity to the division of mitochondria.
23907611 Overexpression of FoxM1 and Plk1 in Fis1-depleted cells restores mitotic entry.
23713734 Fis1 expression is significantly increased in spinal cord in a transgenic mouse model of amyotrophic lateral sclerosis.
23077178 Fis1 acts as a mitochondrial recruitment factor for TBC1D15 that is involved in regulation of mitochondrial morphology.
22789569 Fis1 activity depends on its ability to interconvert between monomer and dimer species
22595523 PEX11 proteins attract both Mff and human Fis1 (hFis1) to their site of action.
22340708 Fis1 and dynamin-related protein (Drp)1 levels are remarkably increased in peripheral blood lymphocytes of Alzheimer's disease patients.
21183955 The mitochondrial fission protein Fission 1 homologue (Fis1) conveys an apoptosis signal from the mitochondria to the ER by interacting with Bap31 at the ER and facilitating its cleavage into the pro-apoptotic p20Bap31.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20428767 we observed interactions between Drp1 and Fis1 in mitochondrial fragmentation induced by increasing mitochondrial calcium
20179104 There is a Drp1- and Fis1-induced, and PINK1-mediated protection mechanism in senescent cells.
19864424 hFis1 can bind to multiple amino acid sequences selectively, and the tetratricopeptide repeat constitutes the main binding region of hFis1.
18845145 oligomerization of hFis1 in the mitochondrial outer membrane plays a role in mitochondrial fission, potentially through participating in fission factor recruitment.
18832378 Fis1 and Mfn1 activities influence mitochondrial signal generation thereby insulin exocytosis.
18782765 targeting of hFis1 to peroxisomes and mitochondria are independent events and support a direct, Pex19p-dependent targeting of peroxisomal tail-anchored proteins.
18515060 Changes correlate with mitochondrial dysfunction rather than with fragmentation, as substantiated by Fis1 mutants with different effects on organelle shape and function
17884824 the concave surface of the Fis1 tetratricopeptide repeat-like domain is evolutionarily conserved to bind the dynamin-like GTPase Dnm1 and not Mdv1 as previously predicted
17545159 hFis1 and OPA1 modulate cellular senescence
17408615 Fis1 plays important roles in peroxisome division and maintenance of peroxisome morphology in mammalian cells, possibly in a concerted manner with Pex11pbeta and DLP1.
16914522 hFis1 is a bifunctional protein that independently regulates mitochondrial fragmentation and endoplasmic reticulum-mediated apoptosis.
16883569 Direct induction of mitochondrial elongation by blocking mitochondrial fission process with Fis1-DeltaTM or Drp1-K38A was sufficient to develop senescent phenotypes with increased Reactive oxygen species production.
16118244 TPR region of hFis1 participates in the interaction with DLP1 or DLP1-containing complex and that the first helix (alpha1) of hFis1 is required for mitochondrial fission presumably by regulating DLP1-hFis1 interaction.
16107562 These findings provide the first evidence for a role of Fis1 in peroxisomal fission and suggest that the fission machinery of mitochondria and peroxisomes shares common components.
16010987 Fis1 together with dynamin-related protein (Drp1) antogonizes Bcl-2.
15356267 Fis1, Drp1, and Opa1 have roles in apoptosis
15024001 hFis1 induces mitochondrial fragmentation and perinuclear clustering in a state of calcium homeostasis
14996942 the level of Fis1 at the mitochondrial surface influences mitochondrial fission events and hence overall mitochondrial morphology within the cell
14705031 Cytosolic domain of fis1 adopts a tetratricopeptide repeat domain fold.
12861026 regulates mitochondrial fission in mammalian cells through an interaction with the dynamin-like protein DLP1
12783892 hFis1 is part of the mammalian fission machinery and regulation of the fission processes might be involved in apoptotic mechanisms

AA Sequence

MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQ      1 - 70
RDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLA     71 - 140
GLIGLAVSKSKS                                                              141 - 152
//

Text Mined References (57)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25843291 2015 miR-483-5p determines mitochondrial fission and cisplatin sensitivity in tongue squamous cell carcinoma by targeting FIS1.
25822260 2015 Mitochondrial dynamics protein Drp1 is overexpressed in oncocytic thyroid tumors and regulates cancer cell migration.
25416956 2014 A proteome-scale map of the human interactome network.
24416201 2014 Identification of novel molecular markers for prognosis estimation of acute myeloid leukemia: over-expression of PDCD7, FIS1 and Ang2 may indicate poor prognosis in pretreatment patients with acute myeloid leukemia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23921378 2013 Adaptor proteins MiD49 and MiD51 can act independently of Mff and Fis1 in Drp1 recruitment and are specific for mitochondrial fission.
23907611 2014 Human mitochondrial Fis1 links to cell cycle regulators at G2/M transition.
23713734 2013 Mitochondrial fusion and fission proteins expression dynamically change in a murine model of amyotrophic lateral sclerosis.
23530241 2013 Interchangeable adaptors regulate mitochondrial dynamin assembly for membrane scission.
23283981 2013 Fis1, Mff, MiD49, and MiD51 mediate Drp1 recruitment in mitochondrial fission.
23077178 2013 Fis1 acts as a mitochondrial recruitment factor for TBC1D15 that is involved in regulation of mitochondrial morphology.
22789569 2012 A designed point mutant in Fis1 disrupts dimerization and mitochondrial fission.
22595523 2012 PEX11 proteins attract Mff and human Fis1 to coordinate peroxisomal fission.
22340708 2012 Mitochondrial fission proteins in peripheral blood lymphocytes are potential biomarkers for Alzheimer's disease.
21701560 2011 Human MIEF1 recruits Drp1 to mitochondrial outer membranes and promotes mitochondrial fusion rather than fission.
21699783 2011 TLE1 modifies the effects of NOD2 in the pathogenesis of Crohn's disease.
21269460 2011 Initial characterization of the human central proteome.
21183955 2011 Fis1 and Bap31 bridge the mitochondria-ER interface to establish a platform for apoptosis induction.
21149567 2010 Mff is an essential factor for mitochondrial recruitment of Drp1 during mitochondrial fission in mammalian cells.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20826455 2010 PEX11 family members are membrane elongation factors that coordinate peroxisome proliferation and maintenance.
20451243 2010 Peroxisomes are signaling platforms for antiviral innate immunity.
20428767 2010 Specific mitochondrial calcium overload induces mitochondrial fission in prostate cancer cells.
20179104 2010 Decreased expression of Drp1 and Fis1 mediates mitochondrial elongation in senescent cells and enhances resistance to oxidative stress through PINK1.
20178365 2010 A proteome-wide perspective on peroxisome targeting signal 1(PTS1)-Pex5p affinities.
19946888 2010 Defining the membrane proteome of NK cells.
19864424 2010 Identification and characterization of unique proline-rich peptides binding to the mitochondrial fission protein hFis1.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18845145 2008 The mitochondrial outer membrane protein hFis1 regulates mitochondrial morphology and fission through self-interaction.
18832378 2008 Selective actions of mitochondrial fission/fusion genes on metabolism-secretion coupling in insulin-releasing cells.
18782765 2008 Targeting of hFis1 to peroxisomes is mediated by Pex19p.
18515060 High levels of Fis1, a pro-fission mitochondrial protein, trigger autophagy.
18353969 2008 The novel tail-anchored membrane protein Mff controls mitochondrial and peroxisomal fission in mammalian cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17884824 2007 Direct binding of the dynamin-like GTPase, Dnm1, to mitochondrial dynamics protein Fis1 is negatively regulated by the Fis1 N-terminal arm.
17545159 2007 Mitochondrial fission and fusion mediators, hFis1 and OPA1, modulate cellular senescence.
17408615 2007 Fis1, DLP1, and Pex11p coordinately regulate peroxisome morphogenesis.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16914522 2006 The mitochondrial fission protein hFis1 requires the endoplasmic reticulum gateway to induce apoptosis.
16883569 2006 Formation of elongated giant mitochondria in DFO-induced cellular senescence: involvement of enhanced fusion process through modulation of Fis1.
16874301 2006 A novel mitochondrial ubiquitin ligase plays a critical role in mitochondrial dynamics.
16118244 2005 Regulation of mitochondrial fission and apoptosis by the mitochondrial outer membrane protein hFis1.
16107562 2005 A role for Fis1 in both mitochondrial and peroxisomal fission in mammalian cells.
16010987 2005 Regulation of Ca2+-induced permeability transition by Bcl-2 is antagonized by Drpl and hFis1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15356267 2004 Roles of the mammalian mitochondrial fission and fusion mediators Fis1, Drp1, and Opa1 in apoptosis.
15024001 2004 Ca(2+) homeostasis during mitochondrial fragmentation and perinuclear clustering induced by hFis1.
14996942 2004 Levels of human Fis1 at the mitochondrial outer membrane regulate mitochondrial morphology.
14705031 2004 Cytosolic domain of the human mitochondrial fission protein fis1 adopts a TPR fold.
14623186 2003 The solution structure of human mitochondria fission protein Fis1 reveals a novel TPR-like helix bundle.
14561759 2004 Proteomic analysis of rat liver peroxisome: presence of peroxisome-specific isozyme of Lon protease.
12861026 2003 The mitochondrial protein hFis1 regulates mitochondrial fission in mammalian cells through an interaction with the dynamin-like protein DLP1.
12853948 2003 The DNA sequence of human chromosome 7.
12783892 2003 hFis1, a novel component of the mammalian mitochondrial fission machinery.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10810093 2000 Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.