Property Summary

NCBI Gene PubMed Count 24
PubMed Score 13.11
PubTator Score 15.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
ovarian cancer -1.400 7.7e-05
adrenocortical carcinoma -1.439 3.6e-02
Chronic Lymphocytic Leukemia 2.515 2.6e-05
ependymoma 1.300 5.4e-04
glioblastoma 1.900 4.2e-03
interstitial cystitis 1.700 5.2e-04
intraductal papillary-mucinous adenoma (... -1.600 3.8e-03
intraductal papillary-mucinous carcinoma... -1.500 1.0e-02
intraductal papillary-mucinous neoplasm ... -1.400 2.9e-02
invasive ductal carcinoma -1.200 1.3e-02
lung cancer -1.300 5.8e-04
lung carcinoma -1.100 2.4e-14
malignant mesothelioma -2.600 1.5e-08
medulloblastoma, large-cell 1.200 2.0e-04
non-small cell lung cancer -1.100 1.1e-08
osteosarcoma 2.999 7.9e-04
pancreatic cancer 1.200 4.5e-03
pituitary cancer 2.200 2.0e-06
sonic hedgehog group medulloblastoma 1.400 1.2e-03
ulcerative colitis 2.100 1.4e-04

Gene RIF (10)

AA Sequence

MRSRGSDTEGSAQKKFPRHTKGHSFQGPKNMKHRQQDKDSPSESDVILPCPKAEKPHSGNGHQAEDLSRD      1 - 70
DLLFLLSILEGELQARDEVIGILKAEKMDLALLEAQYGFVTPKKVLEALQRDAFQAKSTPWQEDIYEKPM     71 - 140
NELDKVVEKHKESYRRILGQLLVAEKSRRQTILELEEEKRKHKEYMEKSDEFICLLEQECERLKKLIDQE    141 - 210
IKSQEEKEQEKEKRVTTLKEELTKLKSFALMVVDEQQRLTAQLTLQRQKIQELTTNAKETHTKLALAEAR    211 - 280
VQEEEQKATRLEKELQTQTTKFHQDQDTIMAKLTNEDSQNRQLQQKLAALSRQIDELEETNRSLRKAEEE    281 - 350
LQDIKEKISKGEYGNAGIMAEVEELRKRVLDMEGKDEELIKMEEQCRDLNKRLERETLQSKDFKLEVEKL    351 - 420
SKRIMALEKLEDAFNKSKQECYSLKCNLEKERMTTKQLSQELESLKVRIKELEAIESRLEKTEFTLKEDL    421 - 490
TKLKTLTVMFVDERKTMSEKLKKTEDKLQAASSQLQVEQNKVTTVTEKLIEETKRALKSKTDVEEKMYSV    491 - 560
TKERDDLKNKLKAEEEKGNDLLSRVNMLKNRLQSLEAIEKDFLKNKLNQDSGKSTTALHQENNKIKELSQ    561 - 630
EVERLKLKLKDMKAIEDDLMKTEDEYETLERRYANERDKAQFLSKELEHVKMELAKYKLAEKTETSHEQW    631 - 700
LFKRLQEEEAKSGHLSREVDALKEKIHEYMATEDLICHLQGDHSVLQKKLNQQENRNRDLGREIENLTKE    701 - 770
LERYRHFSKSLRPSLNGRRISDPQVFSKEVQTEAVDNEPPDYKSLIPLERAVINGQLYEESENQDEDPND    771 - 840
EGSVLSFKCSQSTPCPVNRKLWIPWMKSKEGHLQNGKMQTKPNANFVQPGDLVLSHTPGQPLHIKVTPDH    841 - 910
VQNTATLEITSPTTESPHSYTSTAVIPNCGTPKQRITILQNASITPVKSKTSTEDLMNLEQGMSPITMAT    911 - 980
FARAQTPESCGSLTPERTMSPIQVLAVTGSASSPEQGRSPEPTEISAKHAIFRVSPDRQSSWQFQRSNSN    981 - 1050
SSSVITTEDNKIHIHLGSPYMQAVASPVRPASPSAPLQDNRTQGLINGALNKTTNKVTSSITITPTATPL   1051 - 1120
PRQSQITVEPLLLPH                                                          1121 - 1135
//

Text Mined References (28)

PMID Year Title