Property Summary

NCBI Gene PubMed Count 11
PubMed Score 6.25
PubTator Score 19.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
Amyotrophic lateral sclerosis 1.002 1.5e-04
astrocytic glioma -1.200 2.8e-02
Atopic dermatitis -1.200 4.0e-03
atypical teratoid / rhabdoid tumor -1.100 7.4e-03
ductal carcinoma in situ -1.300 8.9e-03
ependymoma 1.200 1.7e-03
glioblastoma -1.500 1.6e-02
group 4 medulloblastoma -1.400 2.4e-02
intraductal papillary-mucinous adenoma (... -1.700 5.5e-03
intraductal papillary-mucinous carcinoma... -1.200 7.3e-04
intraductal papillary-mucinous neoplasm ... -1.700 3.5e-02
invasive ductal carcinoma -1.900 5.7e-03
lung adenocarcinoma -1.600 5.0e-12
lung carcinoma -1.800 4.7e-22
medulloblastoma, large-cell -1.500 9.7e-03
non primary Sjogren syndrome sicca -1.100 1.5e-02
non-small cell lung cancer -2.418 1.1e-19
osteosarcoma 1.190 3.1e-03
ovarian cancer 1.600 3.2e-03
pituitary cancer 1.200 1.9e-04
psoriasis -1.100 4.7e-25

Gene RIF (2)

AA Sequence

MRSRNQGGESASDGHISCPKPSIIGNAGEKSLSEDAKKKKKSNRKEDDVMASGTVKRHLKTSGECERKTK      1 - 70
KSLELSKEDLIQLLSIMEGELQAREDVIHMLKTEKTKPEVLEAHYGSAEPEKVLRVLHRDAILAQEKSIG     71 - 140
EDVYEKPISELDRLEEKQKETYRRMLEQLLLAEKCHRRTVYELENEKHKHTDYMNKSDDFTNLLEQERER    141 - 210
LKKLLEQEKAYQARKEKENAKRLNKLRDELVKLKSFALMLVDERQMHIEQLGLQSQKVQDLTQKLREEEE    211 - 280
KLKAITSKSKEDRQKLLKLEVDFEHKASRFSQEHEEMNAKLANQESHNRQLRLKLVGLTQRIEELEETNK    281 - 350
NLQKAEEELQELRDKIAKGECGNSSLMAEVENLRKRVLEMEGKDEEITKTESQCRELRKKLQEEEHHSKE    351 - 420
LRLEVEKLQKRMSELEKLEEAFSKSKSECTQLHLNLEKEKNLTKDLLNELEVVKSRVKELECSESRLEKA    421 - 490
ELSLKDDLTKLKSFTVMLVDERKNMMEKIKQEERKVDGLNKNFKVEQGKVMDVTEKLIEESKKLLKLKSE    491 - 560
MEEKVYNLTRERDELIGKLKSEEEKSSELSCSVDLLKKRLDGIEEVEREITRGRSRKGSELTCPEDNKIK    561 - 630
ELTLEIERLKKRLQQLEVVEGDLMKTEDEYDQLEQKFRTEQDKANFLSQQLEEIKHQIAKNKAIEKGEVV    631 - 700
SQEAELRHRFRLEEAKSRDLKAEVQALKEKIHELMNKEDQLSQLQVDYSVLQQRFMEEENKNKNMGQEVL    701 - 770
NLTKELELSKRYSRALRPSVNGRRMVDVPVTSTGVQTDAVSGEAAEEETPAVFIRKSFQEENHIMSNLRQ    771 - 840
VGLKKPVERSSVLDRYPPAANELTMRKSWIPWMRKRENGPSITQEKGPRTNSSPGHPGEVVLSPKQGQPL    841 - 910
HIRVTPDHENSTATLEITSPTSEEFFSSTTVIPTLGNQKPRITIIPSPNVMPQKQKSGDTTLGPERAMSP    911 - 980
VTITTFSREKTPESGRGAFADRPTSPIQIMTVSTSAAPAEIAVSPESQEMPMGRTILKVTPEKQTVPTPV    981 - 1050
RKYNSNANIITTEDNKIHIHLGSQFKRSPGTSGEGVSPVITVRPVNVTAEKEVSTGTVLRSPRNHLSSRP   1051 - 1120
GASKVTSTITITPVTTSSARGTQSVSGQDGSSQRPTPTRIPMSKGMKAGKPVVAAPGAGNLTKFEPRAET   1121 - 1190
QSMKIELKKSAASSTTSLGGGKG                                                  1191 - 1213
//

Text Mined References (13)

PMID Year Title