Property Summary

NCBI Gene PubMed Count 16
PubMed Score 6.07
PubTator Score 6.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
tuberculosis 1.100 1.5e-08
lung cancer 1.600 2.7e-05
ovarian cancer 2.000 2.1e-06

Gene RIF (3)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
17497037 Data Show aFGF was expressed in regenerative hepatocytes, but not in fibroblasts, suggesting its role in promoting oxidative stress produced by hepatocytes may contribute to the development of fibrous bands in hepatic cirrhosis.

AA Sequence

MTSELDIFVGNTTLIDEDVYRLWLDGYSVTDAVALRVRSGILEQTGATAAVLQSDTMDHYRTFHMLERLL      1 - 70
HAPPKLLHQLIFQIPPSRQALLIERYYAFDEAFVREVLGKKLSKGTKKDLDDISTKTGITLKSCRRQFDN     71 - 140
FKRVFKVVEEMRGSLVDNIQQHFLLSDRLARDYAAIVFFANNRFETGKKKLQYLSFGDFAFCAELMIQNW    141 - 210
TLGAVGEAPTDPDSQMDDMDMDLDKEFLQDLKELKVLVADKDLLDLHKSLVCTALRGKLGVFSEMEANFK    211 - 280
NLSRGLVNVAAKLTHNKDVRDLFVDLVEKFVEPCRSDHWPLSDVRFFLNQYSASVHSLDGFRHQALWDRY    281 - 350
MGTLRGCLLRLYHD                                                            351 - 364
//

Text Mined References (20)

PMID Year Title
25096995 2014 Proteomic analysis of the human cyclin-dependent kinase family reveals a novel CDK5 complex involved in cell growth and migration.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
23382103 2013 Platelet proteome analysis reveals integrin-dependent aggregation defects in patients with myelodysplastic syndromes.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19369195 2009 Large-scale proteomics analysis of the human kinome.
17497037 2007 Angiogenic factor expression in hepatic cirrhosis.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12145206 2002 Binding of FGF-1 variants to protein kinase CK2 correlates with mitogenicity.
11964394 2002 Identification of ribosome-binding protein p34 as an intracellular protein that binds acidic fibroblast growth factor.
11509569 2001 Enhancement of fibroblast growth factor (FGF) activity by an FGF-binding protein.
11104667 2000 Organization, chromosomal localization and promoter analysis of the gene encoding human acidic fibroblast growth factor intracellular binding protein.
9806903 1998 Cloning of an intracellular protein that binds selectively to mitogenic acidic fibroblast growth factor.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.