Property Summary

NCBI Gene PubMed Count 18
PubMed Score 4.37
PubTator Score 9.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
Breast cancer -2.700 7.3e-25
active Crohn's disease -1.002 3.9e-02
active ulcerative colitis -1.078 3.2e-02
atypical teratoid / rhabdoid tumor -1.500 8.8e-03
breast carcinoma -1.100 6.2e-17
chronic rhinosinusitis -1.023 2.0e-02
cutaneous lupus erythematosus -1.600 1.6e-02
cystic fibrosis 4.263 4.3e-07
invasive ductal carcinoma -1.300 1.1e-02
lung adenocarcinoma 1.200 1.0e-02
lung cancer 2.400 4.5e-05
malignant mesothelioma -2.300 1.3e-08
nasopharyngeal carcinoma 1.400 2.7e-02
non-small cell lung cancer 1.077 9.5e-06
ovarian cancer 1.300 1.4e-03
psoriasis -1.200 1.1e-06
severe asthma -1.100 6.2e-05

Gene RIF (9)

AA Sequence

MATLACRVQFLDDTDPFNSTNFPEPSRPPLFTFREDLALGTQLAGVHRLLQAPHKLDDCTLQLSHNGAYL      1 - 70
DLEATLAEQRDELEGFQDDAGRGKKHSIILRTQLSVRVHACIEKLYNSSGRDLRRALFSLKQIFQDDKDL     71 - 140
VHEFVVAEGLTCLIKVGAEADQNYQNYILRALGQIMLYVDGMNGVINRNETIQWLYTLIGSKFRLVVKTA    141 - 210
LKLLLVFVEYSESNAPLLIQAVTAVDTKRGVKPWSNIMEILEEKDGVDTELLVYAMTLVNKTLSGLPDQD    211 - 280
TFYDVVDCLEELGIAAVSQRHLNKKGTDLDLVEQLNIYEVALRHEDGDETTEPPPSGCRDRRRASVCSSG    281 - 350
GGEHRGLDRRRSRRHSVQSIKSTLSAPTSPCSQSAPSFKPNQVRDLREKYSNFGNNSYHSSRPSSGSSVP    351 - 420
TTPTSSVSPPQEARLERSSPSGLLTSSFRQHQESLAAERERRRQEREERLQRIEREERNKFRYKYLEQLA    421 - 490
AEEHEKELRSRSVSRGRADLSLDLTSPAAPACLAPLSHSPSSSDSQEALTVSASSPGTPHHPQASAGDPE    491 - 560
PESEAEPEAEAGAGQVADEAGQDIASAHEGAETEVEQALEQEPEERASLSEKERQNEGVNERDNCSASSV    561 - 630
SSSSSTLEREEKEDKLSRDRTTGLWPAGVQDAGVNGQCGDILTNKRFMLDMLYAHNRKSPDDEEKGDGEA    631 - 700
GRTQQEAEAVASLATRISTLQANSQTQDESVRRVDVGCLDNRGSVKAFAEKFNSGDLGRGSISPDAEPND    701 - 770
KVPETAPVQPKTESDYIWDQLMANPRELRIQDMDFTDLGEEDDIDVLDVDLGHREAPGPPPPPPPTFLGL    771 - 840
PPPPPPPLLDSIPPPPVPGNLLVPPPPVFNAPQGLGWSQVPRGQPTFTKKKKTIRLFWNEVRPFDWPCKN    841 - 910
NRRCREFLWSKLEPIKVDTSRLEHLFESKSKELSVSKKTAADGKRQEIIVLDSKRSNAINIGLTVLPPPR    911 - 980
TIKIAILNFDEYALNKEGIEKILTMIPTDEEKQKIQEAQLANPEIPLGSAEQFLLTLSSISELSARLHLW    981 - 1050
AFKMDYETTEKEVAEPLLDLKEGIDQLENNKTLGFILSTLLAIGNFLNGTNAKAFELSYLEKVPEVKDTV   1051 - 1120
HKQSLLHHVCTMVVENFPDSSDLYSEIGAITRSAKVDFDQLQDNLCQMERRCKASWDHLKAIAKHEMKPV   1121 - 1190
LKQRMSEFLKDCAERIIILKIVHRRIINRFHSFLLFMGHPPYAIREVNINKFCRIISEFALEYRTTRERV   1191 - 1260
LQQKQKRANHRERNKTRGKMITDSGKFSGSSPAPPSQPQGLSYAEDAAEHENMKAVLKTSSPSVEDATPA   1261 - 1330
LGVRTRSRASRGSTSSWTMGTDDSPNVTDDAADEIMDRIVKSATQVPSQRVVPRERKRSRANRKSLRRTL   1331 - 1400
KSGLTPEEARALGLVGTSELQL                                                   1401 - 1422
//

Text Mined References (22)

PMID Year Title