Property Summary

NCBI Gene PubMed Count 39
PubMed Score 37.30
PubTator Score 37.38

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
non-small cell lung cancer -1.047 2.0e-11
subependymal giant cell astrocytoma 1.119 3.6e-02
lung carcinoma -1.200 5.4e-17
spina bifida 1.099 4.0e-02

Gene RIF (23)

PMID Text
25555464 Immunostaining of sections of hearts with both anti-FHOD1 antibodies confirmed the presence of FHOD1 in intercalated discs and double immunostaining demonstrated its colocalisation with cadherin, plakoglobin and shifted localization to connexin43.
25125170 Report FODH1 expression in cardiomyocytes and increased expression in dilated cardiommyopathy.
24880667 the diaphanous formin FHOD1 as an interaction partner of N2G
24481812 FHOD1 promotes formation of short actin filaments and transiently associates with transverse arcs providing tight temporal and spatial control of the formation and turnover of transverse arcs into mature ventral stress fibers during dynamic cell behavior.
24086398 FHOD1 participates in cytoskeletal changes in epithelial-mesenchymal transition.
23613471 Cdh1 contributes to spatiotemporal organization of AurB activity, and organization of FHOD1 activity by AurB contributes to daughter cell spreading after mitosis.
23444374 FHOD1 stabilizes actin filaments by protecting barbed ends from depolymerization with its dimeric FH2 domain, whereas the region N-terminal to the FH1 domain mediates F-actin bundling by simultaneously binding to the sides of adjacent F-actin filaments.
22490440 SIRPalpha/CD172a and FHOD1 are unique markers of littoral cells, a recently evolved major cell population of red pulp of human spleen.
22144583 FHOD1 and PPM1F (direct regulators of the actin cytoskeleton) were identified as novel targets of miR-200c. Expression levels of FHOD1 and PPM1F were inversely correlated with miR-200c level in breast cancer cell lines and breast cancer patient samples.
21605332 Letter: G-protein coupled and ITAM receptor regulation of the formin FHOD1 through Rho kinase in platelets.
21106951 FHOD1 is a critical regulator of smooth muscle cell phenotype and is regulated by ROCK-dependent phosphorylation.
18786395 Mutation of one residue in the predicted DAD-interaction surface efficiently activates FHOD1 in cells.
18694941 The Diaphanous-related Formin FHOD1 associates with ROCK1 and promotes Src-dependent plasma membrane blebbing.
18239683 FHOD1 is activated through phosphorylation by rho-dependent protein kinase (ROCK)and has an important function in stress fibre formation in vascular endothelial cells
17909294 In this study, the N-terminal region (residues 1-339) of the human formin homology domain-containing protein 1 (FHOD1) was purified and crystallized.
17013756 This study demonstrates FHOD1 is cleaved by caspase-3 at the SVPD(616) site during apoptosis and the C-terminal FHOD1 cleavage product has the ability to inhibit RNA polymerase I transcription.
16361249 in FHOD1, DAD acts as signal sequence for binding to the well folded and monomeric FH3 domain
16112087 These novel data demonstrate that FHOD1-ERK MAP kinase interaction regulates key aspects of FHOD1 biology.
15878344 Sustained cell elongation is a consequence of FHOD1-mediated actin-microtubule coordination.
15642356 Oligomerization of FHOD1 via the coiled-coil motif is a critical parameter for its biological activities.
15051728 FHOD1 has a role in cyclic GMP-dependent inhibition of vascular smooth muscle cell stress fiber formation and/or migration
14576350 Fhos directly binds to F-actin via the N-terminal region, forms a homotypic complex via the FH2 domain to organize actin cytoskeleton
12677009 FHOS mediates an interaction between GLUT4/IRAP (insulin-responsive aminopeptidase) -containing vesicles and the cytoskeleton and may participate in exocytosis and/or retention of this membrane compartment

AA Sequence

MAGGEDRGDGEPVSVVTVRVQYLEDTDPFACANFPEPRRAPTCSLDGALPLGAQIPAVHRLLGAPLKLED      1 - 70
CALQVSPSGYYLDTELSLEEQREMLEGFYEEISKGRKPTLILRTQLSVRVNAILEKLYSSSGPELRRSLF     71 - 140
SLKQIFQEDKDLVPEFVHSEGLSCLIRVGAAADHNYQSYILRALGQLMLFVDGMLGVVAHSDTIQWLYTL    141 - 210
CASLSRLVVKTALKLLLVFVEYSENNAPLFIRAVNSVASTTGAPPWANLVSILEEKNGADPELLVYTVTL    211 - 280
INKTLAALPDQDSFYDVTDALEQQGMEALVQRHLGTAGTDVDLRTQLVLYENALKLEDGDIEEAPGAGGR    281 - 350
RERRKPSSEEGKRSRRSLEGGGCPARAPEPGPTGPASPVGPTSSTGPALLTGPASSPVGPPSGLQASVNL    351 - 420
FPTISVAPSADTSSERSIYKARFLENVAAAETEKQVALAQGRAETLAGAMPNEAGGHPDARQLWDSPETA    421 - 490
PAARTPQSPAPCVLLRAQRSLAPEPKEPLIPASPKAEPIWELPTRAPRLSIGDLDFSDLGEDEDQDMLNV    491 - 560
ESVEAGKDIPAPSPPLPLLSGVPPPPPLPPPPPIKGPFPPPPPLPLAAPLPHSVPDSSALPTKRKTVKLF    561 - 630
WRELKLAGGHGVSASRFGPCATLWASLDPVSVDTARLEHLFESRAKEVLPSKKAGEGRRTMTTVLDPKRS    631 - 700
NAINIGLTTLPPVHVIKAALLNFDEFAVSKDGIEKLLTMMPTEEERQKIEEAQLANPDIPLGPAENFLMT    701 - 770
LASIGGLAARLQLWAFKLDYDSMEREIAEPLFDLKVGMEQLVQNATFRCILATLLAVGNFLNGSQSSGFE    771 - 840
LSYLEKVSEVKDTVRRQSLLHHLCSLVLQTRPESSDLYSEIPALTRCAKVDFEQLTENLGQLERRSRAAE    841 - 910
ESLRSLAKHELAPALRARLTHFLDQCARRVAMLRIVHRRVCNRFHAFLLYLGYTPQAAREVRIMQFCHTL    911 - 980
REFALEYRTCRERVLQQQQKQATYRERNKTRGRMITETEKFSGVAGEAPSNPSVPVAVSSGPGRGDADSH    981 - 1050
ASMKSLLTSRPEDTTHNRRSRGMVQSSSPIMPTVGPSTASPEEPPGSSLPSDTSDEIMDLLVQSVTKSSP   1051 - 1120
RALAARERKRSRGNRKSLRRTLKSGLGDDLVQALGLSKGPGLEV                             1121 - 1164
//

Text Mined References (48)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25555464 2015 Distribution of formins in cardiac muscle: FHOD1 is a component of intercalated discs and costameres.
25125170 2014 The formin FHOD1 in cardiomyocytes.
24880667 2014 FHOD1 interaction with nesprin-2G mediates TAN line formation and nuclear movement.
24481812 2014 FHOD1 regulates stress fiber organization by controlling the dynamics of transverse arcs and dorsal fibers.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24086398 2013 FHOD1, a formin upregulated in epithelial-mesenchymal transition, participates in cancer cell migration and invasion.
23613471 2013 Spatiotemporal organization of Aurora-B by APC/CCdh1 after mitosis coordinates cell spreading through FHOD1.
23444374 2013 FHOD1 is a combined actin filament capping and bundling factor that selectively associates with actin arcs and stress fibers.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22490440 2012 SIRP?/CD172a and FHOD1 are unique markers of littoral cells, a recently evolved major cell population of red pulp of human spleen.
22144583 2012 MicroRNA-200c represses migration and invasion of breast cancer cells by targeting actin-regulatory proteins FHOD1 and PPM1F.
21605332 2011 G-protein coupled and ITAM receptor regulation of the formin FHOD1 through Rho kinase in platelets.
21269460 2011 Initial characterization of the human central proteome.
21106951 2011 Formin homology domain-containing protein 1 regulates smooth muscle cell phenotype.
19946888 2010 Defining the membrane proteome of NK cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18786395 2008 The human formin FHOD1 contains a bipartite structure of FH3 and GTPase-binding domains required for activation.
18694941 2008 The Diaphanous-related Formin FHOD1 associates with ROCK1 and promotes Src-dependent plasma membrane blebbing.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18239683 2008 The mammalian formin FHOD1 is activated through phosphorylation by ROCK and mediates thrombin-induced stress fibre formation in endothelial cells.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18088087 2008 Phosphoproteome of resting human platelets.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17909294 2007 Purification, crystallization and preliminary structural characterization of the N-terminal region of the human formin-homology protein FHOD1.
17013756 2006 Caspase-3 cleaves the formin-homology-domain-containing protein FHOD1 during apoptosis to generate a C-terminal fragment that is targeted to the nucleolus.
16361249 2006 Biochemical characterization of the diaphanous autoregulatory interaction in the formin homology protein FHOD1.
16112087 2005 The mammalian formin FHOD1 interacts with the ERK MAP kinase pathway.
15878344 2005 FHOD1 coordinates actin filament and microtubule alignment to mediate cell elongation.
15642356 2005 Oligomerization of the diaphanous-related formin FHOD1 requires a coiled-coil motif critical for its cytoskeletal and transcriptional activities.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15231747 2004 A protein interaction framework for human mRNA degradation.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15138285 2004 EBV attachment stimulates FHOS/FHOD1 redistribution and co-aggregation with CD21: formin interactions with the cytoplasmic domain of human CD21.
15095401 2004 Identification of FHOD1-binding proteins and mechanisms of FHOD1-regulated actin dynamics.
15051728 2004 Formin homology domain protein (FHOD1) is a cyclic GMP-dependent protein kinase I-binding protein and substrate in vascular smooth muscle cells.
15010865 2004 Identification and characterization of human FHOD3 gene in silico.
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.
14576350 2003 Fhos, a mammalian formin, directly binds to F-actin via a region N-terminal to the FH1 domain and forms a homotypic complex via the FH2 domain to promote actin fiber formation.
12677009 2003 The Formin family protein, formin homolog overexpressed in spleen, interacts with the insulin-responsive aminopeptidase and profilin IIa.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12665555 2003 The formin-homology-domain-containing protein FHOD1 enhances cell migration.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11590143 2001 The formin/diaphanous-related protein, FHOS, interacts with Rac1 and activates transcription from the serum response element.
10352228 1999 Identification and characterization of a protein containing formin homology (FH1/FH2) domains.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.