Property Summary

NCBI Gene PubMed Count 37
PubMed Score 3.43
PubTator Score 7.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Gene RIF (11)

PMID Text
24667918 Microarray analysis indicates HIV-1 Tat-induced downregulation of four and a half LIM domains 5 (FHL5) in primary human brain microvascular endothelial cells
23127979 Identified CREB activators MAPKAPK3 and FHL5 as mediators of intimal hyperplasia in vein graft samples.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20488182 Results indicate that SPAG8 acts as a regulator of ACT and plays an important role in CREM-ACT-mediated gene transcription during spermatogenesis.
20471030 This protein has been found differentially expressed in thalami from patients with schizophrenia.
20378615 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
17368652 Observational study of gene-disease association. (HuGE Navigator)
16687568 Observational study of gene-disease association. (HuGE Navigator)
16687568 Different haplotypes within the ACT gene may contribute to male factor subfertility.
12039695 No difference was found in the levels of ICER transcripts in thyroid adenomas and surrounding normal tissue (obtained at surgery), independently of the TSH receptor gene status.

AA Sequence

MTTAHFYCQYCTASLLGKKYVLKDDSPYCVTCYDRVFSNYCEECKKPIESDSKDLCYKDRHWHEGCFKCT      1 - 70
KCNHSLVEKPFAAKDERLLCTECYSNECSSKCFHCKRTIMPGSRKMEFKGNYWHETCFVCENCRQPIGTK     71 - 140
PLISKESGNYCVPCFEKEFAHYCNFCKKVITSGGITFCDQLWHKECFLCSGCRKDLCEEQFMSRDDYPFC    141 - 210
VDCYNHLYANKCVACSKPISGLTGAKFICFQDSQWHSECFNCGKCSVSLVGKGFLTQNKEIFCQKCGSGM    211 - 280
DTDI                                                                      281 - 284
//

Text Mined References (37)

PMID Year Title
26660531 2016 Gene-based pleiotropy across migraine with aura and migraine without aura patient groups.
26231841 2015 Association of genetic loci for migraine susceptibility in the she people of China.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23127979 2013 Cyclic adenosine monophosphate response-element binding protein activation by mitogen-activated protein kinase-activated protein kinase 3 and four-and-a-half LIM domains 5 plays a key role for vein graft intimal hyperplasia.
23088713 2012 Protein interactions of the transcription factor Hoxa1.
22683712 2012 Genome-wide association analysis identifies susceptibility loci for migraine without aura.
22319020 2012 A genome-wide association study for coronary artery disease identifies a novel susceptibility locus in the major histocompatibility complex.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21459774 2011 An autosomal locus that controls chromosome-wide replication timing and mono-allelic expression.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20488182 2010 Sperm associated antigen 8 (SPAG8), a novel regulator of activator of CREM in testis during spermatogenesis.
20471030 2010 Proteome analysis of the thalamus and cerebrospinal fluid reveals glycolysis dysfunction and potential biomarkers candidates for schizophrenia.
20378615 2010 Evaluation of 172 candidate polymorphisms for association with oligozoospermia or azoospermia in a large cohort of men of European descent.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17368652 2008 A SNP in the ACT gene associated with astrocytosis and rapid cognitive decline in AD.
16825108 2006 Regulation of gene expression in post-meiotic male germ cells: CREM-signalling pathways and male fertility.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16687568 2006 Sequencing and haplotype analysis of the activator of CREM in the testis (ACT) gene in populations of fertile and infertile males.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16336258 2005 Transcription factors governing male fertility.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15705296 2005 Genetic control of spermiogenesis: insights from the CREM gene and implications for human infertility.
15610731 2004 The SRF target gene Fhl2 antagonizes RhoA/MAL-dependent activation of SRF.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15151709 2004 A specific programme of gene transcription in male germ cells.
14742698 2004 Expression of activator of CREM in the testis (ACT) during normal and impaired spermatogenesis: correlation with CREM expression.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12493914 2002 CREM-dependent transcription in male germ cells controlled by a kinesin.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12039695 2002 Expression of cAMP-responsive element binding protein and inducible cAMP early repressor in hyperfunctioning thyroid adenomas.
11420126 2001 Transcriptional cascades during spermatogenesis: pivotal role of CREM and ACT.
11327716 2001 Cloning and expression of activator of CREM in testis in human testicular tissue.
11046156 2000 A family of LIM-only transcriptional coactivators: tissue-specific expression and selective activation of CREB and CREM.
10086359 1999 CBP-independent activation of CREM and CREB by the LIM-only protein ACT.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.