Property Summary

NCBI Gene PubMed Count 26
PubMed Score 5.66
PubTator Score 23.93

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis 1.700 4.5e-05
osteosarcoma 1.204 2.7e-04
Duchenne muscular dystrophy -1.241 4.8e-07
autosomal dominant Emery-Dreifuss muscul... -1.098 1.3e-02
juvenile dermatomyositis -1.157 2.4e-09
acute quadriplegic myopathy -1.165 8.0e-05

Gene RIF (14)

PMID Text
25659096 the present study established a link between Ang and FHL3 proteins and identifies a new pathway for regulating astrocytoma progression.
24998228 PCBP2 could bind to FHL3 mRNA 3'UTR-A and inhibited the expression of FHL3 in T98G glioms cells
24690879 These findings suggest that functional interactions between FHL3 and MT-1X may provide some clues to the mechanisms of FHL3-regulated cell proliferation.
23616667 FHL3 enhances Tax1-mediated activation of the Human T-cell leukemia virus type 1 long terminal repeat (LTR) without affecting basal activity and regulates NF-kappaB activation by Tax1 in a cell-specific manner.
22633874 findings suggest that the interaction between Ang and FHL3 may provide some clues to the mechanisms of Ang-regulated cell growth and apoptosis
22362714 FHL3 suppressed anchorage-dependent and -independent growth of human breast cancer cells.
22219185 FHL3 does not bind to HIF-1alpha or p300, indicating that it regulates transactivation by a novel molecular mechanism.
20586194 the second zinc finger motif in LIM4 was responsible for the auto-activation of FHL3.
19139564 Human four-and-a-half LIM family members suppress tumor cell growth through a TGF-beta-like signaling pathway.
18187620 Knockdown of four and a half LIM domains 3 (FHL3) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17389685 FHL3 association with MyoD may contribute to the regulation of MyoD-dependent transcription of muscle genes and thereby myogenesis
15453830 MZF-1 and FHL3 formed a complex of high molecular mass with some additional proteins in the nucleus. Transcriptional repression of FcepsilonRI by MZF-1 required FHL3.
15117962 FHL2 and FHL3, respectively, are colocalized with alpha(7)beta(1) integrin receptor at the periphery of Z-discs, suggesting a role in mechanical stabilization of muscle cells
12681290 Data show that FHL3 (human four-and-a-half LIM-only protein 3) interacts with human phosphatase CDC25B in the cell nucleus.

AA Sequence

MSESFDCAKCNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCR      1 - 70
CQRSLADEPFTCQDSELLCNDCYCSAFSSQCSACGETVMPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRS     71 - 140
FVPDKGAHYCVPCYENKFAPRCARCSKTLTQGGVTYRDQPWHRECLVCTGCQTPLAGQQFTSRDEDPYCV    141 - 210
ACFGELFAPKCSSCKRPIVGLGGGKYVSFEDRHWHHNCFSCARCSTSLVGQGFVPDGDQVLCQGCSQAGP    211 - 280
//

Text Mined References (32)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25659096 2015 Angiogenin promotes U87MG cell proliferation by activating NF-?B signaling pathway and downregulating its binding partner FHL3.
25416956 2014 A proteome-scale map of the human interactome network.
24998228 2014 Ribotrap analysis of proteins associated with FHL3 3'untranslated region in glioma cells.
24690879 2014 Identification and characterization of MT-1X as a novel FHL3-binding partner.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23616667 2013 The four and a half LIM family members are novel interactants of the human T-cell leukemia virus type 1 Tax oncoprotein.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22633874 2012 Identification and characterization of FHL3 as a novel angiogenin-binding partner.
22362714 2011 Downregulation and antiproliferative role of FHL3 in breast cancer.
22219185 2012 Four-and-a-half LIM domain proteins inhibit transactivation by hypoxia-inducible factor 1.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21269460 2011 Initial characterization of the human central proteome.
20586194 Identification of the transactivation domain of the human FHL3.
19139564 2009 Human four-and-a-half LIM family members suppress tumor cell growth through a TGF-beta-like signaling pathway.
17389685 2007 FHL3 binds MyoD and negatively regulates myotube formation.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15453830 2005 FHL3 negatively regulates human high-affinity IgE receptor beta-chain gene expression by acting as a transcriptional co-repressor of MZF-1.
15117962 2004 The LIM-only proteins FHL2 and FHL3 interact with alpha- and beta-subunits of the muscle alpha7beta1 integrin receptor.
14729955 2004 Extracellular signal-regulated kinase 2 interacts with and is negatively regulated by the LIM-only protein FHL2 in cardiomyocytes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12704194 2003 FHL3 is an actin-binding protein that regulates alpha-actinin-mediated actin bundling: FHL3 localizes to actin stress fibers and enhances cell spreading and stress fiber disassembly.
12681290 2003 LIM-only protein FHL3 interacts with CDC25B2 phosphatase.
12556451 2003 The LIM protein FHL3 binds basic Krüppel-like factor/Krüppel-like factor 3 and its co-repressor C-terminal-binding protein 2.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11135358 2001 Protein-protein interaction of FHL3 with FHL2 and visualization of their interaction by green fluorescent proteins (GFP) two-fusion fluorescence resonance energy transfer (FRET).
10226657 1998 Chromosomal mapping of a skeletal muscle specific LIM-only protein FHL3 to the distal end of the short arm of human chromosome 1.
10049693 1999 The LIM proteins FHL1 and FHL3 are expressed differently in skeletal muscle.
8753811 1996 Slim defines a novel family of LIM-proteins expressed in skeletal muscle.