Property Summary

NCBI Gene PubMed Count 297
PubMed Score 769.66
PubTator Score 752.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.693 7.4e-06
Common variable immunodeficiency -1.219 8.3e-03
sarcoidosis -1.300 2.1e-03
inflammatory breast cancer -1.200 1.5e-04

Protein-protein Interaction (1)

Gene RIF (248)

PMID Text
27060312 Mutations of the FHIT gene are not major cause of Peutz-Jeghers syndrome.
26929601 FHIT hypermethylation, which induces the inactivation of FHIT gene, plays an important role in the carcinogenesis and clinical outcome and may serve as a potential diagnostic marker and drug target of non-small-cell lung carcinoma
26745060 Low FHIT Gene Expression is associated with Acute Lymphoblastic Leukemia.
26491255 Review/Meta-analysis: FHIT methylation could be a diagnostic biomarker of breast carcinogenesis.
26406001 The results showed that the methylation levels of both BRCA1 and FHIT promoters were higher in the serum of the breast ductal carcinoma group than those of the breast fibroadenoma group.
26181368 Adenylylsulfate-ammonia adenylyltransferase activity is another inherent property of Fhit proteins.
25735361 FHIT promotor hypermethylation is associated with the development of breast cancer.
25720522 Hypermethylation of FHIT gene is associated with Epstein-Barr virus-associated gastric carcinomas.
25711523 Fhit nuclear translocation upon mitogenic stimulation may represent a new regulatory mechanism that allows rapid restoration of Fhit cytoplasmic levels and promotes the proliferation cascade activated by mitogenic stimulation
25486479 Data are consistent with a mechanism in which Fhit protein is required for accumulation of the transcriptional repressor of HMOX1, Bach1 protein.
25460508 Data indicate that fragile histidine triad protein [FHIT) contributes partially to radioresistance and predicts clinical outcomes in irradiated oral cancer.
25422218 Patients with FHIT methylation might promote cervical cancer progression.
25401976 APOBEC3B overexpression and Fhit-loss induced DNA damage are independent events that, when occurring together, result in a significantly increased frequency of APOBEC-induced mutations that drive cancer progression.
25340791 we demonstrate that the expression pattern of FHIT and miR-30c is inversely correlated with that of MTDH and HMGA2 in normal tissue, non-metastatic and metastatic tumors, serving as a potential biomarker for metastasis in lung cancer.
25283145 Loss of FHIT function leads to nucleotide imbalance, spontaneous replication stress, and DNA breaks. [review]
25098403 The Fhit possesses diadenosine triphosphate hydrolase activity, but although reduction of its enzymatic activity appears to be important for exerting its tumor suppressor function, the regulation of Fhit activity is poorly understood.
25040980 The total frequency of FHIT, RASSF1A and RARbeta gene methylation was significantly higher in lung cancer.
24998847 the induction of Slug expression by AKT/NF-kappaB signaling pathway due to FHIT loss not only promotes tumor invasion, but also confers cisplatin resistance due to Slug-mediated PUMA reduction in lung cancer cells.
24935385 methylation of FHIT is a useful biomarker of biologically aggressive disease in patients with non-small cell lung carcinomas
24909176 the decrease in the expression of miR-29b by c-Myc may be responsible for FHIT loss-mediated tumor aggressiveness and for poor outcome in non-small cell lung cancer.
24757411 FHIT expression can block the PI3K-Akt pathway by suppressing phosphorylation of Akt in cholangiocarcinoma cells.
24729090 our meta-analysis provides evidences that negative expression of FHIT protein may be correlated with poor prognosis in patients with gastric cancer
24667261 Hypermethylation of FHIT gene promoter region was found more frequent in cancer tissue than controls.
24556720 Results identify a novel member of the miR-548 family in the fourth intron of the human FHIT gene.
24370550 Reduced expression of FHIT gene is associated with the progression of colon adenocarcinoma.
24223161 Fhit delocalizes annexin A4 from plasma membrane to cytosol and sensitizes lung cancer cells to paclitaxel.
24185125 FHIT loss was observed in 64% of non-small-cell lung carcinoma patients and was significantly associated with squamous cell carcinoma and poor tumor grade.
23993961 These results showed that Fhit was up-regulated specifically by activating Galpha subunits of the Gq subfamily but not by those of the other G protein subfamilies.
23991058 Data indicate that expression of several predicted chimeric genes and genes with disrupted exon structure including ALK, NBAS, FHIT, PTPRD and ODZ4 in neuroblastoma.
23969757 Our results suggest that loss of Fhit expression in breast cancer is associated with poor prognostic features, and it is also relevant to the results in HER2-negative breast cancer.
23947369 Consistent with the tumor suppressive function of Fhit, the observations in this study suggest that the formation of Galphaq/Fhit complex may modulate cell proliferation.
23944951 Immunohistochemical staining of oral squamous cell carcinoma shows that Fhit negativity is associated with cervical lymph node metastasis and poor disease-specific survival.
23929738 FHIT gene is a "caretaker gene" necessary for maintenance of genome stability.
23797051 FHIT reduced or lost protein expression is associated with microsatellite instable and CpG island methylator phenotype-high in colorectal cancer.
23780737 findings show that in normal cells a small but significant percentage of abnormal sequence patterns may be found within the FHIT gene, at the same genomic region that is involved in many cancer rearrangements; this effect is detectable in different types of proliferating and resting cells, in the absence of exogenous stress
23736021 The detection rates of FHIT and p16 mRNA loss were significantly higher in malignant than in benign pleural effusion.
23724516 loss of heterozygosity may be related to menopause in women with breast disorders
23709347 In 22 lung cancer patients with negative histology and cytology at initial bronchoscopy, FHIT and p16 mRNA loss was detected in 40.9% (9/22) and 36.4% (8/22) cases, respectively.
23494221 The expressions of DAPK1, FHIT, MGMT, and CDKN2A were detected The methylation of the promoter region significantly decreased the expression of only DAPK1
23404381 Loss of FHIT gene is associated with squamous cell carcinomas of the vulva.
23209436 We propose that loss of Fhit expression in precancerous lesions is the first step in the initiation of genomic instability, linking alterations at common fragile sites to the origin of genome instability.
23131390 At multivariate analysis Apc and Fhit expression were independent predictors for gastric cancer specific survival.
23102829 Loss of Fhit expression contributes to cell transformation.
23019410 FHIT is lost in a majority of chordomas provides new insight into chordoma pathogenesis and points to a potential new therapeutic target for this challenging neoplasm.
22932087 FHIT expression did not differ appreciably among the malignant and benign parathyroid tumor types.
22843886 we found that nuclear FHIT expression could be used as a good marker to distinguish PSA from Ca-ex-PA
22766745 these data indicated that methylation of the FHIT promoter region is an early event during hepatocellular carcinoma development.
22613411 There was a significant association between negative FHIT expression in bladder urothelial carcinoma and advanced tumour stage, high pathological grade, large tumour size, tumour recurrence and reduced survival time.
22578181 These results suggest that CNA of MYC and FHIT are poor prognostic markers, and risk stratification based on the copy-number status of those genes is useful to select the optimal treatment strategy in resected ESCC patients.
22425911 transcriptional deregulation after FHIT modulation was higher in p53-negative cells
22393963 role of FHIT expression in bladder carcinogenesis and progression; FHIT was expressed in carcinoma and adjacent normal tissues at mRNA and protein levels, but 17 kDa FHIT was lower in tumors; negative correlation between FHIT expression and histological grade of bladder transitional cell carcinoma but no clear relationship with stage or relapse
22315171 The expression of CD133 may be inversely correlated with the expression of FHIT.
21928112 The methylation status at the promoter regions of GATA6, MGMT, and FHIT in glioblastoma, was examined.
21870644 FHIT gene deletions could be important in the development and/or progression of urinary bladder cancers and may be used as an independent prognostic indicator for the clinical outcome in patients with these tumors.
21830375 increased FHIT gene activity can promote apoptosis of cholangiocarcinoma and reduce the expression level of cyclin D1.
21711110 microRNA-143 protects cells from DNA damage-induced killing by downregulating FHIT expression
21685375 Using the Affymetrix 6.0 SNP array, the study shows that tumor suppressor genes FHIT and WWOX are deleted in primary effusion lymphoma cell lines.
21679157 HIV-1 Tat-fused fragile histidine triad (FHIT) can robustly inhibit growth and induce apoptosis of human hepatocellular carcinoma cells
21668571 FHIT was negative in normal and dysplastic squamous epithelium as well as in a percentage of cancers, indicating that FHIT expression may not be associated with esophageal pathologies.
21617227 Gene mutations and polymorphisms of FHIT is associated with esophageal carcinoma.
21557333 FHIT is underexpressed in breast cancer tissues compared to their normal counterparts due to the extensive allelic loss that is observed in its gene structure.
21404710 Expression rates of FHIT and PTEN in prostate cancer were significantly lower than in benign prostatic nodular hyperplasia.
21258320 FRA3B instability is specific to cells showing this particular DNA replication initiation pattern
21241597 FHIT could be a target at which Yunnan tin mine dust induces transformation of BEAS-2B cells.
21095196 the significant association of FHIT mutation and hypermethylation leads to the complete inactivation of FHIT gene in patients with breast cancer
20864512 Observational study of gene-disease association, gene-gene interaction, and genetic testing. (HuGE Navigator)
20864173 Data show that methylation of at least one gene was detected in 18 patients (45%), the genes methylated were CDKN2B (20%), RASSF1 (18%), RARB (10%), CDH13 (7.5%) and FHIT (5%).
20814237 5'-CpG island hypermethylation of the FHIT gene is associated with lung cancer.
20690795 restoration of FHIT gene expression inhibits tumor cell growth in a human cutaneous T-cell lymphoma cell line
20689140 Homozygous deletion but not mutation of exons 5 and 8 of the fragile histidine triad gene is associated with features of differentiated thyroid carcinoma.
20689140 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20622329 The loss of FHIT and over-expression of MDM2 may play an important role in the carcinogenesis of oral submucous fibrosis.
20606729 methylation of the promoter region may play a key role in inactivation of FHIT - possibly leading to subsequent carcinogenesis and progression of differentiated thyroid carcinoma
20552362 Allelic imbalance at FHIT locus is a common event and contributes to pathology in nasopharyngeal carcinoma patients in Chinese endemic area.
20510001 Absent/reduced FHIT and WWOX expression is associated with poor prognosis in hepatocellular carcinoma.
20458975 Homozygosis of FHIT gene that was made by deletion or methylation had been found in all the cancerous tissues of the studied patients.
20435627 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20417865 These data suggest that concomitant allelic losses of the BRCA1 and FHIT genes are associated with more aggressive breast tumors.
20399571 We concluded that FHIT expression remains to be positive, at least in early lesions of basal cell carcinoma
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20306291 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20095356 CyclinB1, FHIT and Ki-67 may play significant roles in the occurrence and evolution of gastric carcinoma.
20083853 reduction or absence of the FHIT gene expression is not a prerequisite for colorectal cancer development and progression
20083852 The local up-regulation of FHIT gene and protein expression in active ulcerative colitis may represent an adequate response against inflammatory challenge
20082323 Genetic and epigenetic studies of the FHIT locus, are summarized.
20060399 ATR protein preferentially binds (directly or through complexes) to fragile site FRA3B as compared to non-fragile site regions, under conditions of mild replication stress
20060354 results suggest that, as for breast cancer, loss of Fhit and Wwox expression might have a role in the pathogenesis of basaloid differentiation in salivary gland neoplasms.
19931269 Expression of Fhit is significantly directly correlated with absence of activated Chk1 in dysplasia, suggesting a connection between loss of Fhit and modulation of checkpoint activity.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19760177 Data suggest that the reduction or loss of Fhit protein expression by genetic alterations or epigenetic mechanisms in glioblastoma multiforme might be associated with brain tumorigenesis.
19751438 The decreased FHIT gene expression associated with hereditary factors and with H. pylori infection, especially with vacA(+)cagA(+)-positive strains.
19730990 Novel missense mutation in FHIT gene: interpreting the effect in HPV-mediated cervical cancer in Indian women
19728916 5-Aza-dC can reverse the abnormal methylation of FHIT gene, activate the silenced gene and induce FHIT mRNA and protein expression in HepG2 cells.
19622739 Intramitochondrial calcium regulation by the FHIT gene product sensitizes to apoptosis.
19621594 High deletion rate of the FHIT gene in Chinese hypopharyngeal squamous cell carcinoma suggested the FHIT gene plays an important role in the tumor carcinogenesis, development and progression of the tumor.
19621594 Observational study of gene-disease association. (HuGE Navigator)
19620087 Fhit may play an important role in the development of endometriosis.
19502167 DNMT3b may play an important role in regulation of FHIT expression in hepatoma SMMC-7721 cells, but not through methylation of the FHIT promoter.
19452299 Genomic instability in FHIT gene in the form of MSI and LOH was observed in gallbladder cancer > xanthogranulomatous cholecystitis > chronic cholecystitis, but was not seen in normal GB. XGC showed more LOH than CC.
19434452 Loss of FHIT is associated with pancreatobiliary cancers.
19419937 a strong statistical correlation was revealed of Fhit protein expression in the main mass of tumour with patients' age (p=0.04) and tumour location in the stomach.
19418484 Data show that FHIT expression in lung cancer cells is protective from TRAIL-induced apoptosis, and that FHIT exerts this protective effect downstream of TRAIL-receptors and likely requires its dinucleoside-triphosphate hydrolase activity.
19414370 Silent mutation in exon 7 of FHIT gene is associated with the advanced grades of megaesophagus and esophageal carcinogenesis
19414370 Observational study of gene-disease association. (HuGE Navigator)
19401904 Fhit prevents ionizing radiation-induced HPRT mutation and preventing mutation through low dose of ionizing radiation-induced adaptive response is Fhit independent.
19339270 Observational study of gene-disease association. (HuGE Navigator)
19286306 inhibition of Fhit hydrolase activity might be a crucial element in a Fhit-driven cancer cells death
19267103 Mutation of the FHIT gene is assopciated with lung cancer.
19267103 Observational study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
19130459 Reduced expression levels of Fhit protein is associated with the pathogenesis of basal-like differentiation in breast cancer.
19096006 Results indicate that different molecular mechanisms interplay to inactivate FHIT expression and support the proposition that FHIT methylation in normal lung tissue could represent a prognostic marker for progressive disease.
19004824 substrate binding, interaction with heat shock proteins, mitochondrial localization, and interaction with Fdxr are important for Fhit tumor suppressor function
18985481 The FHIT gene might function to inhibit the proliferation and tumorigenicity of MEC-1 cells, and to induce the differentiation of MEC-1 cells, in vitro and in vivo.
18953408 Involvement of the FHIT intronic region in an increased risk of prostate cancer.
18953408 Observational study of gene-disease association. (HuGE Navigator)
18690840 FHIT-/p53+ status might be a biological variable influencing the efficacy of carboplatin/gemcitabine treatment in non-small cell lung cancer.
18618300 Loss of FHIT protein is associated with cholangiocarcinoma.
18608185 Study indicates a correlation between the promoter methylation of FHIT and RASSF1A genes and the clinical stage and histological grading of cervical carcinoma in Indian women.
18595145 Transduction of FHIT gene inhibits the growth of human hepatocellular carcinoma cells and induces cell apoptosis in vivo and in vitro.
18567082 FHIT expression was lost or reduced in a minor fraction of hepatocellular carcinoma tissues, while it was strongly expressed in non-cancerous liver tissues.
18517280 a role for FHIT (in addition to VHL) in renal tumorigenesis
18494825 No correlation between AI/LOH of the FHIT gene and reduced/absent FHIT expression was detected in the cutaneous squamous cell carcinoma samples.
18476633 The loss of FHIT expression may be correlated with the development and progression of laryngeal carcinoma.
18426086 FHIT is frequently inactivated by exon skipping, intron retention, and activation of cryptic splice site within exon 6 in colorectal cancer
18378390 Our results suggest that hypermethylation of the FHIT 5'CpG island may be responsible for inactivation of the FHIT gene in clear cell renal carcinomas.
18367246 Myelodysplastic syndrome patients with FHIT gene methylation had significantly shorter survival time than those without FHIT methylation.
18338497 The FHIT gene may be turned off in brain metastases via other genetic/epigenetic mechanisms rather than mutations.
18338496 FHIT gene mutations in the formation of breast cancer. FHIT mutations were detected in 13 of the 67 malignant cases (19.4%) and 2 of the 16 benign cases (12.5%).
18319262 Fhit interaction with ferredoxin reductase triggers generation of reactive oxygen species and apoptosis of cancer cells
18299890 Methylation of FHIT gene was frequently found than HPV infection, therefore methylation of the FHIT gene is suggested to play an important role in the pathogenesis of penile squamous cell carcinoma.
18247301 FHIT gene hypermethylation might be one of the molecular events involved in the disease progression of MDS.
18221322 Aberrations could be considered markers responsible for the development of odontogenic lesions.
18162546 tumor-like microdeletions in FHIT/FRA3B are induced by replication stress
18097574 aberrant Fhit and Mlh1 expression could be related to colorectal carcinoma de novo (DN) carcinogenesis.
18091387 Down-regulated expression of FHIT and PTEN may contribute to gastric carcinogenesis possibly by involving in the imbalance between apoptosis and proliferation of cells.
18077326 These observations assign to the tumor suppressor Fhit an unexpected role in the regulation of beta-catenin-mediated gene transcription.
18038314 Loss of FHIT does not interfere with tumour proliferation. This can be accepted as evidence for an early role of FHIT loss in carcinogenesis.
18006149 Results support the view that Ap3A is the in vivo Fhit ligand and that an inhibition of Fhit activity is a key element in Fhit-mediated apoptosis.
17846126 Observational study of gene-disease association. (HuGE Navigator)
17712558 MTHFR variants were not related to FHIT hypermethylation in diffuse large B-cell lymphoma.
17694439 Microsatellite instability and loss of heterozygosity in FHIT gene could be detected in sputum of lung cancer patients.
17671701 Expression may be reduced in some early gastric carcinomas.
17609851 Observational study of gene-disease association. (HuGE Navigator)
17609851 The polymorphisms and haplotypes in the FHIT gene are not associated with lung cancer in the Korean population.
17596760 FHIT expression did not significantly correlate with high grade cervical precancerous lesion.
17562266 Deletion and abnormal expression of FHIT gene are common in Yunnan tin miners and non-miners with lung cancer.
17548701 Observational study of gene-disease association. (HuGE Navigator)
17548701 rs760317 may be in linkage disequilibrium with one or more prostate cancer susceptibility variants in or near FHIT
17393360 absence or poor expression of the Fhit protein in anal cancers suggests a role for this tumor suppressor gene product, as a risk factor, in the onset of this cancer, as reported before for other gastrointestinal tumors
17382535 The researchers found evidence that FHIT inhibits some mechanisms involved in colorectal carcinogenesis.
17380463 FHIT expression was significantly correlated with lymph node metastasis, apoptosis, Duke's stage and 5-year survival rate in rectal carcinoma.
17374991 Review of the molecular interconnection data argue for cooperation between Fhit and HER2 in breast carcinogenesis.
17373735 The FHIT gene plays an important role in the regulation of apoptosis and decreased FHIT expression plays a key role in the initiation and progression of colorectal carcinoma.
17359554 nasopharyngeal carcinoma patients with high titres of IgA against Epstein-Barr virus capsid antigen showed frequent loss of heterozygosity. Allelic loss at the FRA3B site occurs significantly more commonly in endemic nasopharyngeal carcinoma patients.
17348444 FHIT was more highly expressed in large cell carcinomas and adenocarcinomas, and higher in females than males.
17328863 FHIT induces apoptosis through a sequential activation of death receptor-mediated pro-apoptotic signaling pathways in human non-small-cell lung cancer cells
17164758 FHIT underexpression was detected in 27% of carcinoma in situ and 41% of invasive carcinoma, which suggests that it could be useful in assessing those carcinoma in situ lesions (ductal, DCIS and lobular, LCIS).
17143956 FHIT protein expression is completely absent or reduced in inflammatory bowel disease, indicating that it may be associated with the oncogenesis and disease progression
17142325 Such a scenario would suggest a key role for Fhit in the balance of proliferation/survival/apoptosis signals
17137614 Fhit status on immunohistochemistry staining demonstrated significant association with tumor aggressiveness, and staining of biopsy specimens for Fhit is worthy of study as a prognostic tool.
17119051 fragile histidine triad and c-kit have roles in progression of fragile histidine triad and c-kit
17037022 The reduced expression of Fhit may be associated with carcinogenesis and prognosis of nasal and paranasal sinus carcinomas.
17029211 CpG island methylation of FHIT gene in plasma plays an important role on cervical cancer, which results in decreased expression of FHIT protein.
16990010 PpIX inhibits the enzymatic activity of Fhit; PpIX induced HeLa cell death in Fhit and Fhit-H96N-dependent manner; HeLa cells stably expressing Fhit or mutant Fhit-H96N were more susceptible to protoporphyrin IX-mediated photodynamic therapy
16963412 CpG island methylation of the FHIT gene is prevalent in the plasma and tissue samples from cervical cancer patients.
16864578 Nit1 and Fhit share tumor suppressor signaling pathways, while localization of the NIT1 gene at a stable chromosome site explains the paucity of gene alterations and in frequent loss of expression of the NIT1 gene in human malignancies.
16773697 Loss of heterozygosity (LOH) of fragile histidine triad (FHIT) gene is correlated with invasive gastric carcinoma, and microsatellite instabi1ities (MSI) of FHIT gene is correlated with lymph node metastases.
16763940 Fhit protein is preferentially expressed in the nucleus of monocyte-derived cells
16740775 FHIT restoration in some FHIT-deficient leukemia cells induces both antiproliferative and proapoptotic effects involving the intrinsic caspase apoptotic pathway.
16739375 The expression of Fhit is significantly associated with histological grade and lymphatic metastasis in hypopharyngeal squamous cell carcinoma.
16733051 These results altogether suggest that Fhit functions as an anti-oncoprotein by inhibiting the phosphorylation of IkappaB-alpha and thereby blocking NF-kappaB signaling.
16699861 The high frequency of methylation of the FHIT gene promoter suggests that the inactivation of tumor suppressor genes and of the genes related to the control of cellular proliferation through this mechanism is involved in gallbladder carcinogenesis.
16698048 The majority of the malignant thyroid cancers displayed aberrant expression of FHIT gene, concominant with p53 gene inactivation.
16570269 Our results show that nicotine induces methylation of the FHIT gene followed by loss of Fhit protein expression in human esophageal squamous epithelial cells.
16533421 FHIT has a role in the response to cisplatin-based chemotherapy as well as in the reversal of drug resistance in NSCLC
16513840 Loss of FHIT expression and methylation of the FHIT gene promoter is associated with advanced lung cancer
16359767 Diadenosine triphosphatase was isolated from platelets and leukocytes and was identified with the novel tumour suppressor Fhit protein by biochemical and immunochemical evidence.
16242161 Replication timing of FRA3B in G2 was studied by bromodeoxyuridine (BrdU) labeling by a fluorescence in situ hybridization (FISH)-based approach through the analysis of clones spanning the FRA3B region.
16231322 paclitaxel-induced apoptosis enhanced by FHIT expression in lung cancer cells might be associated with modulation of Bcl-2-caspase signaling
16217683 in gastric cancer, the lack of Fhit expression significantly correlated with the diffuse histotype, more advanced tumor stage and lymph node involvement
16115913 Findings suggest that the tumor suppressor gene FHIT may represent a molecular target in cigarette smoking-associated cervical carcinogenesis.
15998374 Reduced Fhit expression in invasive ductal carcinoma in-situ (DCIS) breast cancer was associated, which may contribute to the high-grade DCIS-invasive tumor pathway.
15949315 Reintroduction of exogeneous FHIT can obviously suppress the proliferation and tumorigenicity in human lung cancer cell line A549 and induce apoptosis.
15935551 Frequent FHIT gene loss of heterozygosity is associated with human papillomavirus-infected non-smoking female lung cancer
15929169 Epstein Barr virus infection might influence carcinogenesis of gastric cancer by inducing the abnormality of FHIT gene
15906520 The frequencies of LOH and MSI in the two microsatellite sites, D3S1234 and D3S1300, of FHIT gene might play a role in the carcinogenesis and development of laryngeal squamous cell carcinoma.
15902282 FHIT methylation was accumulated through the disease progression of MDS and AML, and the role of the FHIT gene as a tumor suppressor seemed different in AML and MDS
15835917 The decreases in the values of K(m) and k(cat) for the phosphorylated forms in comparison to those of unphosphorylated Fhit favor the formation and lifetime of the Fhit-Ap(3)A complex, which may enhance the tumor suppressor activity of Fhit.
15798093 UV-induced alterations of the FHIT and WWOX fragile site gene expression are involved at least partially in the checkpoint function of DNA damage
15674328 FHIT hypermethylation analys9s could enrich a panel of DNA methylation markers in breast, lung and bladder cancer.
15633221 FHIT may play an important role in carcinogenesis and development of hepatoma.
15569992 Fhit has a role in bladder cancer development
15489891 Fhit protein exerts its oncosuppressor activity through induction of an apoptotic mechanism that seems to be FADD dependent, caspase-8 mediated and independent from mitochondrial amplification
15480422 genomic loss of the FHIT gene is one of the causes of the generation of aberrant transcripts
15384174 epigenetic modification frequently results in loss of FHIT expression in Burkitt's lymphoma
15361849 tumour suppressor properties of Fhit are strictly related to its expression level
15328196 Head and neck tumors lacking Fhit expression my be more sensitive to surgery and postoperative radiotherapy.
15246872 diadenosine triphosphate hydrolase activity of the putative tumor suppressor protein Fhit is inhibited by Ubc9
15231689 FHIT may cooperate with p16 gene for the development of squamous cell carcinoma of lung in individuals exposed to tobacco smoke.
15219888 Aberrant methylation assay is not concordant with FHIT gene expression, and should suggest caution in its use as a functionally relevant biomarker for cervical cancer.
15182206 reaction mechanism: Mg(2+) in the reaction of Ap(3)A is required for the first step, the formation of the covalent intermediate Fhit-AMP, and not for the hydrolysis of the intermediate in the second step
15080505 FHIT expression is frequently altered in human kidney cancer cell lines by alternative splicing, and suggest the FHIT protein may play a pivotal role in regulating intracellular metabolism of the distal convoluted tubule and collecting duct in maturity
15080495 aberrant FHIT transcripts in gastric cancer cell lines resulted from faulty splicing, including exon skipping, selection of cryptic splice site and additional downstream splice processing
15073846 Reduced FHIT expression associated with adverse prognosis in breast cancer
15060557 Hepatocellular carcinomas retained expression of normal FHIT mRNA transcripts, but also showed universal expression of smaller sized aberrant transcripts and commonly overexpressed these aberrant transcripts.
15044096 The data suggest that E2F-1 overexpression plays a role in suppression of tumor, at least in part trough transcriptional regulation of FHIT and relevant activation of WWOX.
15026336 Hypermethylation of the 5' CpG island of the FHIT gene is associated with hyperdiploid and translocation-negative subtypes of pediatric leukemia
14991669 The study suggests that mitochondria are involved in the apoptotic activity of FHIT.
14760383 reduced Fhit expression occurs in the early stage of gastric carcinogenesis and could be correlated with a lack of Mlh1 expression and gastric phenotype
14719099 p16INK4a and Fhit expression is altered in carcinogenesis and progression of human oral cancer
14719066 Abnormal FHIT mRNA expression is noted frequently in NHL cell lines and a certain proportion of NHL patients, and decreased FHIT protein expression indicates a significantly worse prognosis in diffuse large B-cell lymphoma.
14675322 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
14660280 5'-CpG island methylation plays an important role in inactivation of the FHIT gene in cervical cancer
14630947 Human and mouse orthologous genes, FHIT and Fhit, are more highly conserved through evolution than PTPRG/Ptprg and yet contain more sequence elements that are exquisitely sensitive to genomic rearrangements
14569398 present data indicate a frequent decrease of Fhit protein expression, thus supporting the significance of FHIT inactivation in development of malignant mesothelioma
14566838 FHIT is an independent prognostic factor that distinguishes a subgroup of patients with breast cancer who could benefit from adjuvant treatment.
12969785 Reduced fragile histidine triad gene expression might be involved in the development of gallbladder carcinoma and be correlated with Mlh1 expression
12964015 Fhit protein has a role in development of colorectal neoplasm
12926121 The loss of Fhit protein expression may be associated with aggressive phenotype of endometrial carcinomas.
12893195 Fhit protein is associated with highly aggressive phenotypes of cervical carcinoma.
12890991 exogenous expression of FHIT in Panc-1 cells affects genes regulating cell cycle arrest and apoptosis, and these molecular changes may contribute to the tumor suppressor activity of the FHIT gene
12839965 Promoter hypermethylation of this gene is demonstrated in esophageal squamous cell carcinoma.
12800227 FHIT inactivation seems to be both an early and a later event, associated with carcinogenesis and progression to more aggressive hepatocellular carcinomas.
12698186 High incidence of abnormal Fhit expression in younger patients and presence of human papillomavirus are key players in cervical carcinogenesis
12697969 results indicated that the disruption of the mismatch repair system of Msh2 does not mainly lead to allelic loss of the FHIT/FRA3B locus as well as microsatellite instability in esophageal cancer
12627509 FHIT tumor suppressor gene is down regulated in prostate carcinoma and may be a potential target for therapeutic intervention
12529969 Loss of Msh2 is not associated with FHIT deletion in breast carcinomas.
12483524 evidence that instability extends further than previously reported and extends over 4 megabases
12452072 expression of Fhit is associated with invasion and metastasis of tumor in breast cancer
12419158 It is suggested that decreased FHIT expression plays an important role in the development and progression of the tumor, and thus may become a new prognostic marker in colorectal carcinoma.
12362975 Abnormal FHIT gene transcript in breast cancer
12353263 The breakpoint t(3;20)(p14;p11) targets the potential tumor-suppressor gene FHIT in the FRA3B region and is accompanied by homozygous deletion of exon 5 of the gene and absence of functional FHIT and fusion transcripts.
12231533 Biallelic FHIT inactivation by LOH & hypermethylation leads to its complete inactivation in breast cancer. Silencing by promoter hypermethylation occurs in primary breast carcinomas, especially those with LOH. FHIT may cause sporadic breast tumorigenesis.
12177781 reduced Fragile histidine triad expression was significantly associated with absence of mismatch repair protein expression in the advanced colorectal carcinomas (
12169206 MYCL1, FHIT, SPARC, p16(INK4) and TP53 genes associated to lung cancer in idiopathic pulmoary fibrosis
12090476 FHIT loss played a role in 23% ofexamined colorectal tumors, mostly poorly differentiated carcinomas. It positively correlated with the rate of distant metastases and bad prognosis. Excess FHIT was directly proportional to the apoptotic rate.
12067991 Identification of unstable sequences within the common fragile site at 3p14.2: implications for the mechanism of deletions within fragile histidine triad gene/common fragile site at 3p14.2 in tumors.
12057912 FHIT gene is one of the chromosome 3p putative tumor suppressor genes involved in the pathogenesis of this highly malignant neoplasm, gallbladder carcinoma
12048684 The result of this study suggests that FHIT gene may be a tumor suppressor gene in human lung cancer cells.
12007194 Exposure to tobacco carcinogens increases the potential for chromosome breakage at fragile site FRA3B.
11915181 Inactivation of the FHIT gene is an early event in carcinogenesis of the endometrium.
11902576 FHIT is missing in most human cancers, indicating it has a tumor suppressor function. Inactivation of only one allele compromises this function, indicating a "one-hit" mechanism of tumorigenesis is operative.
11891319 Restoration of fragile histidine triad (FHIT) expression induces apoptosis and suppresses tumorigenicity in lung and cervical cancer cell lines
11809703 Alterations of the fragile histidine triad gene, FHIT, and its encoded products contribute to testicular germ cell tumorigenesis.
11788890 reduced Fhit protein expression and loss of heterozygosity at FHIT gene in tumours from smoking and asbestos-exposed lung cancer patients
11731438 allelic loss of the FHIT gene may be involved in carcinogenesis in the peripheral lung of patients with IPF.

AA Sequence

MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVE      1 - 70
KHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAA     71 - 140
ALRVYFQ                                                                   141 - 147
//

Text Mined References (298)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
27060312 2016 [Mutations of the STK11 and FHIT genes among patients with Peutz-Jeghers syndrome].
26929601 2016 The clinicopathological significance and ethnic difference of FHIT hypermethylation in non-small-cell lung carcinoma: a meta-analysis and literature review.
26745060 2015 FHIT Gene Expression in Acute Lymphoblastic Leukemia and its Clinical Significance.
26491255 2015 The clinicopathological significance and drug target potential of FHIT in breast cancer, a meta-analysis and literature review.
26406001 2015 Quantitative detection of methylation of FHIT and BRCA1 promoters in the serum of ductal breast cancer patients.
26181368 2015 Adenylylsulfate-ammonia adenylyltransferase activity is another inherent property of Fhit proteins.
25735361 2015 Analysis of FHIT gene methylation in egyptian breast cancer women: association with clinicopathological features.
25720522 2015 Aberrant gene promoter methylation of p16, FHIT, CRBP1, WWOX, and DLC-1 in Epstein-Barr virus-associated gastric carcinomas.
25711523 2015 Fhit Nuclear Import Following EGF Stimulation Sustains Proliferation of Breast Cancer Cells.
25486479 2014 A knockdown with smoke model reveals FHIT as a repressor of Heme oxygenase 1.
25460508 2015 DNA methylome analysis identifies epigenetic silencing of FHIT as a determining factor for radiosensitivity in oral cancer: an outcome-predicting and treatment-implicating study.
25422218 2014 Folate deficiency and FHIT hypermethylation and HPV 16 infection promote cervical cancerization.
25416956 2014 A proteome-scale map of the human interactome network.
25401976 2015 FHIT loss-induced DNA damage creates optimal APOBEC substrates: Insights into APOBEC-mediated mutagenesis.
25340791 2014 FHIT suppresses epithelial-mesenchymal transition (EMT) and metastasis in lung cancer through modulation of microRNAs.
25283145 2014 The FHIT gene product: tumor suppressor and genome "caretaker".
25098403 2014 Selective monitoring of the enzymatic activity of the tumor suppressor Fhit.
25040980 2014 Combined effects methylation of FHIT, RASSF1A and RAR? genes on non-small cell lung cancer in the Chinese population.
24998847 2015 FHIT loss confers cisplatin resistance in lung cancer via the AKT/NF-?B/Slug-mediated PUMA reduction.
24954895 2014 Gene-age interactions in blood pressure regulation: a large-scale investigation with the CHARGE, Global BPgen, and ICBP Consortia.
24935385 2014 Assessment of the prognostic value of methylation status and expression levels of FHIT, GSTP1 and p16 in non-small cell lung cancer in Egyptian patients.
24909176 2015 c-Myc suppresses microRNA-29b to promote tumor aggressiveness and poor outcomes in non-small cell lung cancer by targeting FHIT.
24800985 2014 Genome-wide association study of maternal and inherited loci for conotruncal heart defects.
24757411 2014 Fragile histidine triad (FHIT) suppresses proliferation and promotes apoptosis in cholangiocarcinoma cells by blocking PI3K-Akt pathway.
24729090 2014 Abnormal FHIT protein expression may be correlated with poor prognosis in gastric cancer: a meta-analysis.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
24667261 2014 [The relationship between FHIT gene promoter methylation and lung cancer risk: a meta-analysis].
24556720 2014 Identification of a tumor-suppressive human-specific microRNA within the FHIT tumor-suppressor gene.
24370550 2014 Reduced FHIT expression is associated with tumor progression in sporadic colon adenocarcinoma.
24223161 2013 Fhit delocalizes annexin a4 from plasma membrane to cytosol and sensitizes lung cancer cells to paclitaxel.
24185125 2014 FHIT, EGFR, and MSH2: possible etiopathologic, prognostic, and predictive role in non-small cell lung carcinoma in Egyptian patients.
23993961 2013 Activation of G?q subunits up-regulates the expression of the tumor suppressor Fhit.
23991058 2013 Breakpoint features of genomic rearrangements in neuroblastoma with unbalanced translocations and chromothripsis.
23969757 2013 Promoter methylation status of the FHIT gene and Fhit expression: association with HER2/neu status in breast cancer patients.
23947369 2013 Activation state-dependent interaction between G?q subunits and the Fhit tumor suppressor.
23944951 2013 Recurrent loss of the FHIT gene and its impact on lymphatic metastasis in early oral squamous cell carcinoma.
23929738 2013 Common chromosome fragile sites in human and murine epithelial cells and FHIT/FRA3B loss-induced global genome instability.
23897914 2013 A genome-wide association study (GWAS) for bronchopulmonary dysplasia.
23797051 2013 Reduced FHIT expression is associated with mismatch repair deficient and high CpG island methylator phenotype colorectal cancer.
23780737 2013 Genetic instability of the tumor suppressor gene FHIT in normal human cells.
23736021 2013 Diagnostic value of the FHIT and p16 mRNA loss and the K-ras gene mutation in pleural fluids for malignant pleural effusion.
23724516 2013 Loss of heterozygosity in the fragile histidine triad (FHIT) locus and expression analysis of FHIT protein in patients with breast disorders.
23709347 2013 Detection of FHIT and p16 mRNA deletion in biopsy specimens obtained by bronchoscopy for the diagnosis of lung cancer.
23494221 2014 Promoter methylation of DAPK1, FHIT, MGMT, and CDKN2A genes in cervical carcinoma.
23470693 2013 Genome-wide association studies of pit-and-fissure- and smooth-surface caries in permanent dentition.
23404381 2013 Genomic aberration patterns and expression profiles of squamous cell carcinomas of the vulva.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23209436 2012 Initiation of genome instability and preneoplastic processes through loss of Fhit expression.
23131390 2013 A clinical-biological risk stratification model for resected gastric cancer: prognostic impact of Her2, Fhit, and APC expression status.
23102829 2013 Characterization of the role of Fhit in suppression of DNA damage.
23049088 2012 A genome-wide association study provides evidence for association of chromosome 8p23 (MYP10) and 10q21.1 (MYP15) with high myopia in the French Population.
23019410 2012 High-resolution whole-genome analysis of skull base chordomas implicates FHIT loss in chordoma pathogenesis.
22952603 2012 Genome-wide association study of d-amphetamine response in healthy volunteers identifies putative associations, including cadherin 13 (CDH13).
22932087 2012 Expression of Ki-67, galectin-3, fragile histidine triad, and parafibromin in malignant and benign parathyroid tumors.
22843886 2012 The expression of FHIT in salivary carcinoma ex pleomorphic adenoma.
22766745 2013 Loss of heterozygosity and methylation of multiple tumor suppressor genes on chromosome 3 in hepatocellular carcinoma.
22760553 2012 Genome-wide pharmacogenomic study of citalopram-induced side effects in STAR*D.
22747683 2012 Genetic variants associated with breast size also influence breast cancer risk.
22613411 2012 The significance of fragile histidine triad protein as a molecular prognostic marker of bladder urothelial carcinoma.
22578181 2012 Genomic copy-number alterations of MYC and FHIT genes are associated with survival in esophageal squamous-cell carcinoma.
22425911 2012 Inactivation of both FHIT and p53 cooperate in deregulating proliferation-related pathways in lung cancer.
22419666 2012 Genome wide study of maternal and parent-of-origin effects on the etiology of orofacial clefts.
22393963 2011 Aberrant FHIT expression is linked to bladder carcinogenesis and apoptosis.
22379998 2012 Genome-wide mapping for clinically relevant predictors of lamotrigine- and phenytoin-induced hypersensitivity reactions.
22315171 2012 Correlation of aberrant expression of CD133 with FHIT and malignant phenotype of colorectal adenocarcinoma.
21928112 2012 The promoter hypermethylation status of GATA6, MGMT, and FHIT in glioblastoma.
21870644 2011 Homozygous deletion of the FHIT gene, p21WAF1 protein expression and apoptosis in bilharzial bladder cancer.
21830375 FHIT promotes the apoptosis of QBC939 by reducing the expression of cyclin D1.
21711110 2011 microRNA-143 protects cells from DNA damage-induced killing by downregulating FHIT expression.
21685375 2011 Tumor suppressor genes FHIT and WWOX are deleted in primary effusion lymphoma (PEL) cell lines.
21668571 2012 Immunohistochemical evaluation of p53, FHIT, and IGF2 gene expression in esophageal cancer.
21617227 2011 Gene mutations and polymorphisms of TP53 and FHIT in chronic esophagitis and esophageal carcinoma.
21557333 2011 FHIT gene and flanking region on chromosome 3p are subjected to extensive allelic loss in Egyptian breast cancer patients.
21404710 2011 [Expressions of FHIT and PTEN and their significance in prostate cancer].
21269460 2011 Initial characterization of the human central proteome.
21258320 2011 Cell-type-specific replication initiation programs set fragility of the FRA3B fragile site.
21241597 2010 [Expression of fragile histidine triad (FHIT) protein and Ki-67 in transformed epithelial cells induced by Yunnan tin mine dust].
21223598 2011 Genome-wide joint SNP and CNV analysis of aortic root diameter in African Americans: the HyperGEN study.
21182207 2010 Variants in several genomic regions associated with asperger disorder.
21095196 2011 Mutational and promoter hypermethylation status of FHIT gene in breast cancer patients of Kashmir.
20864512 2010 A panel of sputum-based genomic marker for early detection of lung cancer.
20864173 2011 Aberrant methylation of tumor suppressor genes in patients with refractory anemia with ring sideroblasts.
20814237 2010 Association of 5'-CpG island hypermethylation of the FHIT gene with lung cancer in southern-central Chinese population.
20690795 2010 Restoration of fragile histidine triad (FHIT) expression inhibits cell growth and induces apoptosis in cutaneous T-cell lymphoma cell line.
20689140 2010 Homozygous deletion but not mutation of exons 5 and 8 of the fragile histidine triad (FHIT) gene is associated with features of differentiated thyroid carcinoma.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20622329 2010 [Expression of FHIT and MDM2 in oral submucous fibrosis and canceration tissues].
20606729 2010 Association of the promoter methylation and protein expression of Fragile Histidine Triad (FHIT) gene with the progression of differentiated thyroid carcinoma.
20552362 2010 Allelic imbalance and abnormal expression of FHIT in endemic nasopharyngeal carcinoma: association with clinicopathological features.
20510001 2010 [The relationship between FHIT and WWOX expression and clinicopathological features in hepatocellular carcinoma].
20458975 [Genetic and epigenetic changes of FHIT gene in patients with esophageal cancer].
20435627 2010 Genomic profiling of adult acute lymphoblastic leukemia by single nucleotide polymorphism oligonucleotide microarray and comparison to pediatric acute lymphoblastic leukemia.
20417865 2010 Concomitant loss of heterozygosity at the BRCA1 and FHIT genes as a prognostic factor in sporadic breast cancer.
20399571 2010 Immunohistochemical FHIT expression still exists in early lesions of basal cell carcinoma.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20306291 2010 A three-stage genome-wide association study of general cognitive ability: hunting the small effects.
20125088 2011 Genome-wide association study of recurrent early-onset major depressive disorder.
20095356 2009 [Expressions of cyclinB1, FHIT and Ki-67 in 336 gastric carcinoma patients and their clinicopathologic significance].
20083853 2009 Fragile histidine triad (FHIT) gene is overexpressed in colorectal cancer.
20083852 2009 Overexpression of the fragile histidine triad (FHIT) gene in inflammatory bowel disease.
20082323 2010 Pathology and biology associated with the fragile FHIT gene and gene product.
20060399 2010 ATR preferentially interacts with common fragile site FRA3B and the binding requires its kinase activity in response to aphidicolin treatment.
20060354 2010 Study of FHIT and WWOX expression in mucoepidermoid carcinoma and adenoid cystic carcinoma of salivary gland.
19931269 2010 Fhit loss in lung preneoplasia: relation to DNA damage response checkpoint activation.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19815620 2010 Impaired replication dynamics at the FRA3B common fragile site.
19760177 2010 FHIT gene sequence variants and reduced Fhit protein expression in glioblastoma multiforme.
19751438 2009 Helicobacter pylori infection and family history of gastric cancer decrease expression of FHIT tumor suppressor gene in gastric mucosa of dyspeptic patients.
19730990 2010 Novel missense mutation in FHIT gene: interpreting the effect in HPV-mediated cervical cancer in Indian women.
19728916 2009 [Effect of 5-Aza-dC on FHIT gene expression in hepatocellular carcinoma cell line HepG2].
19717471 2009 Common fragile sites are characterized by histone hypoacetylation.
19622739 2009 Intramitochondrial calcium regulation by the FHIT gene product sensitizes to apoptosis.
19621594 2009 [Mutation and abnormal expression of FHIT gene in hypopharyngeal carcinoma].
19620087 2009 [Expression of fragile histidine triad in endometriosis].
19502167 2009 Influence of DNA methyltransferase 3b on FHIT expression and DNA methylation of the FHIT promoter region in hepatoma SMMC-7721 cells.
19452299 2009 Fragile histidine triad (FHIT) gene and its association with p53 protein expression in the progression of gall bladder cancer.
19434452 2009 Coordinate loss of fragile gene expression in pancreatobiliary cancers: correlations among markers and clinical features.
19419937 2009 Immunohistochemical assessment of Fhit protein expression in advanced gastric carcinomas in correlation with Helicobacter pylori infection and survival time.
19418484 2009 TRAIL-induced apoptosis of FHIT-negative lung cancer cells is inhibited by FHIT re-expression.
19414370 2009 Gene mutations in esophageal mucosa of chagas disease patients.
19401904 2009 Low dose radiation-induced adaptive response preventing HPRT mutation is Fhit independent.
19339270 2009 Genetic associations of 115 polymorphisms with cancers of the upper aerodigestive tract across 10 European countries: the ARCAGE project.
19286306 2009 Aberration of the enzymatic activity of Fhit tumor suppressor protein enhances cancer cell death upon photodynamic therapy similarly to that driven by wild-type Fhit.
19267103 Mutation analysis of the FHIT gene in bronchoscopic specimens from patients with suspected lung cancer.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19130459 2009 Fragile histidine triad protein, WW domain-containing oxidoreductase protein Wwox, and activator protein 2gamma expression levels correlate with basal phenotype in breast cancer.
19096006 2009 Fragile histidine triad gene inactivation in lung cancer: the European Early Lung Cancer project.
19004824 2009 Correlation of fragile histidine triad (Fhit) protein structural features with effector interactions and biological functions.
18985481 2008 Effect of fragile histidine triad gene on biologic properties of muco-epidermoid carcinoma cells.
18953408 2008 Strong signature of natural selection within an FHIT intron implicated in prostate cancer risk.
18821565 2008 Genome-wide association scan of quantitative traits for attention deficit hyperactivity disorder identifies novel associations and confirms candidate gene associations.
18690840 2008 FHIT and p53 status and response to platinum-based treatment in advanced non-small cell lung cancer.
18618300 2008 Inverse correlation of aberrant expression of fragile histidine triad (FHIT) protein with cyclin D1 protein and prognosis in Chinese patients with cholangiocarcinoma.
18608185 2008 Effect of aberrant promoter methylation of FHIT and RASSF1A genes on susceptibility to cervical cancer in a North Indian population.
18595145 2008 Effect of fragile histidine triad gene transduction on proliferation and apoptosis of human hepatocellular carcinoma cells.
18567082 2008 Fragile histidine triad gene alterations are not essential for hepatocellular carcinoma development in South Korea.
18517280 2008 Cytogenetic studies of 24 renal epithelial tumors with von Hippel-Lindau and fragile histidine triad protein expression correlation.
18494825 2008 Analysis of FHIT allelic imbalance/loss of heterozygosity and FHIT expression in cutaneous squamous cell carcinomas.
18476633 2008 [Expression of FHIT gene protein in laryngeal carcinoma].
18426086 2005 Aberrant FHIT transcripts in human colorectal cancers.
18378390 2008 Hypermethylation of the 5'CpG island of the FHIT gene in clear cell renal carcinomas.
18367246 2008 Methylation status of fragile histidine triad (FHIT) gene and its clinical impact on prognosis of patients with myelodysplastic syndrome.
18338497 Investigation of mutations and expression of the FHIT gene in Turkish patients with brain metastases derived from non-small cell lung cancer.
18338496 Importance of novel sequence alterations in the FHIT gene on formation of breast cancer.
18319262 2008 Fhit interaction with ferredoxin reductase triggers generation of reactive oxygen species and apoptosis of cancer cells.
18299890 2008 Frequent epigenetic silencing of the FHIT gene in penile squamous cell carcinomas.
18247301 2008 [Alteration of methylation status of fragile histidine triad gene promoter in patients with myelodysplastic syndrome].
18221322 2008 Alterations of FHIT and P53 genes in keratocystic odontogenic tumor, dentigerous and radicular cyst.
18162546 2008 Replication stress induces tumor-like microdeletions in FHIT/FRA3B.
18097574 2008 Fhit, Mlh1, P53 and phenotypic expression in the early stage of colorectal neoplasms.
18091387 2007 Low expression of FHIT and PTEN correlates with malignancy of gastric carcinomas: tissue-array findings.
18077326 2007 The tumor suppressor Fhit acts as a repressor of beta-catenin transcriptional activity.
18038314 2008 Role of fragile histidine triad protein expression in pathogenesis of malignant pleural mesothelioma.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18006149 2008 Correlation of intracellular diadenosine triphosphate (Ap3A) with apoptosis in Fhit-positive HEK293 cells.
17846126 2007 Identification of novel candidate genes for type 2 diabetes from a genome-wide association scan in the Old Order Amish: evidence for replication from diabetes-related quantitative traits and from independent populations.
17712558 2007 Genetic polymorphisms of methylenetetrahydrofolate reductase and promoter methylation of MGMT and FHIT genes in diffuse large B cell lymphoma risk in Middle East.
17694439 2007 Microsatellite analysis of induced sputum DNA in patients with lung cancer in heavy smokers and in healthy subjects.
17671701 2007 Expression of Fhit, Mlh1, p16INK4A and E-cadherin in early gastric neoplasia: Correlation with histological grade and gastric phenotype.
17609851 2007 Lack of association of fragile histidine triad (FHIT) polymorphisms with lung cancer in the Korean population.
17596760 2007 The association of p16(INK4A) and fragile histidine triad gene expression and cervical lesions.
17562266 2007 [Loss of exons of FHIT gene and FHIT protein expression in Yunnan tin miners with lung cancer].
17548701 2007 Association between germline variation in the FHIT gene and prostate cancer in Caucasians and African Americans.
17393360 FHIT oncosuppressor gene expression profile in human anal cancers.
17382535 2006 Down-regulation of FHIT inhibits apoptosis of colorectal cancer: mechanism and clinical implication.
17380463 2007 [Fragile histidine triad protein expression and correlation with apoptosis in rectal carcinoma].
17374991 2007 Fhit expression protects against HER2-driven breast tumor development: unraveling the molecular interconnections.
17373735 2007 Decreased fragile histidine triad expression in colorectal cancer and its association with apoptosis inhibition.
17359554 2007 Frequent allelic loss at the FRA3B site in endemic nasopharyngeal carcinoma: association with clinical features and Epstein-Barr virus infection.
17348444 Expression of PTEN and FHIT is involved in regulating the balance between apoptosis and proliferation in lung carcinomas.
17328863 2007 Induction of apoptosis by tumor suppressor FHIT via death receptor signaling pathway in human lung cancer cells.
17164758 2007 The expression of FHIT, PCNA and EGFR in benign and malignant breast lesions.
17143956 2006 Loss of fragile histidine triad protein expression in inflammatory bowel disease.
17142325 2006 FHIT-proteasome degradation caused by mitogenic stimulation of the EGF receptor family in cancer cells.
17137614 2007 Abnormal fragile histidine triad (Fhit) expression in invasive cervical adenocarcinoma: association with tumor aggressiveness.
17119051 2006 Coexpression of fragile histidine triad and c-kit is relevant for prediction of survival in patients with small cell lung cancer.
17037022 2006 [Fhit expression and its relationship with apoptosis and prognosis in nasal and paranasal sinus carcinomas].
17029211 2006 [Methylation status of FHIT gene in plasma and expression of FHIT gene in cancer tissue of cervical cancer patients].
16990010 2007 Tumor suppressor Fhit protein interacts with protoporphyrin IX in vitro and enhances the response of HeLa cells to photodynamic therapy.
16963412 2006 [Methylation status of the 5' CpG islands in FHIT gene in the plasma and tissues of cervical cancer patients].
16864578 2006 Biological functions of mammalian Nit1, the counterpart of the invertebrate NitFhit Rosetta stone protein, a possible tumor suppressor.
16773697 2006 Loss of heterozygosity and microsatellite instabilities of fragile histidine triad gene in gastric carcinoma.
16763940 2006 Fhit protein is preferentially expressed in the nucleus of monocyte-derived cells and its possible biological significance.
16740775 2006 Preclinical assessment of FHIT gene replacement therapy in human leukemia using a chimeric adenovirus, Ad5/F35.
16739375 2006 [The relationship between expression of Fhit and biological behaviors of hypopharyngeal carcinoma].
16733051 2006 Fhit protein inhibits cell growth by attenuating the signaling mediated by nuclear factor-kappaB in colon cancer cell lines.
16699861 2006 Promoter methylation profile in gallbladder cancer.
16698048 2006 Molecular genetic alterations of FHIT and p53 genes in benign and malignant thyroid gland lesions.
16570269 2006 Nicotine induces the fragile histidine triad methylation in human esophageal squamous epithelial cells.
16533421 2006 Increased sensitivity to cisplatin in non-small cell lung cancer cell lines after FHIT gene transfer.
16513840 2006 Loss of fragile histidine triad gene expression in advanced lung cancer is consequent to allelic loss at 3p14 locus and promoter methylation.
16407838 2006 Fhit modulation of the Akt-survivin pathway in lung cancer cells: Fhit-tyrosine 114 (Y114) is essential.
16359767 2006 Biochemical and immunochemical characterisation of human diadenosine triphosphatase provides evidence for its identification with the tumour suppressor Fhit protein.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16242161 2006 SMC1 inhibition results in FRA3B expression but has no effect on its delayed replication.
16231322 2006 FHIT protein enhances paclitaxel-induced apoptosis in lung cancer cells.
16217683 2006 Loss of Fhit expression is associated with poorer survival in gastric cancer but is not an independent prognostic marker.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16115913 2005 The fragile histidine triad gene: a molecular link between cigarette smoking and cervical cancer.
15998374 2005 Concordant loss of fragile gene expression early in breast cancer development.
15949315 2005 [Ectogenous fragile histidine triad gene inhibits the malignant phenotype of human lung cancer cell line A549 in vitro and in vivo].
15935551 2006 Frequent FHIT gene loss of heterozygosity in human papillomavirus-infected non-smoking female lung cancer in Taiwan.
15929169 2005 Relationship between abnormality of FHIT gene and EBV infection in gastric cancer.
15906520 2005 [Microsatellite instability and loss of heterozygosity of fragile histidine triad gene in laryngeal squamous cell carcinoma].
15902282 2005 Expression and methylation status of the FHIT gene in acute myeloid leukemia and myelodysplastic syndrome.
15835917 2005 Phosphorylation of the human Fhit tumor suppressor on tyrosine 114 in Escherichia coli and unexpected steady state kinetics of the phosphorylated forms.
15798093 2005 Components of DNA damage checkpoint pathway regulate UV exposure-dependent alterations of gene expression of FHIT and WWOX at chromosome fragile sites.
15674328 2005 Fragile genes as biomarkers: epigenetic control of WWOX and FHIT in lung, breast and bladder cancer.
15633221 2005 Expression of fragile histidine triad in primary hepatocellular carcinoma and its relation with cell proliferation and apoptosis.
15569992 2004 Inactivation of the FHIT gene favors bladder cancer development.
15489891 2004 The apoptotic pathway triggered by the Fhit protein in lung cancer cell lines is not affected by Bcl-2 or Bcl-x(L) overexpression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15480422 2004 Contig array CGH at 3p14.2 points to the FRA3B/FHIT common fragile region as the target gene in diffuse large B-cell lymphoma.
15384174 2004 Frequent silencing of fragile histidine triad gene (FHIT) in Burkitt's lymphoma is associated with aberrant hypermethylation.
15361849 2004 Dose-dependent effect of FHIT-inducible expression in Calu-1 lung cancer cell line.
15328196 2004 Loss of Fhit expression in head and neck squamous cell carcinoma and its potential clinical implication.
15313915 2004 Synergistic tumor suppression by coexpression of FHIT and p53 coincides with FHIT-mediated MDM2 inactivation and p53 stabilization in human non-small cell lung cancer cells.
15246872 2004 Ubc9-induced inhibition of diadenosine triphosphate hydrolase activity of the putative tumor suppressor protein Fhit.
15231689 2004 Aberrant methylation of the FHIT gene in chronic smokers with early stage squamous cell carcinoma of the lung.
15219888 2004 Understanding the mechanisms of FHIT inactivation in cervical cancer for biomarker development.
15182206 2004 The mechanism of action of the fragile histidine triad, Fhit: isolation of a covalent adenylyl enzyme and chemical rescue of H96G-Fhit.
15080505 2002 Expression of the fragile histidine triad gene in normal rat tissues and human kidney cancer cell lines.
15080495 2002 Aberrant splicing of FHIT transcripts in human gastric cancer cell lines.
15073846 2004 The fragile genes FHIT and WWOX are inactivated coordinately in invasive breast carcinoma.
15060557 2004 FHIT mRNA and protein expression in hepatocellular carcinoma.
15044096 2004 Effect of exogenous E2F-1 on the expression of common chromosome fragile site genes, FHIT and WWOX.
15026336 2004 Hypermethylation of the 5' CpG island of the FHIT gene is associated with hyperdiploid and translocation-negative subtypes of pediatric leukemia.
15007172 2004 Fhit is a physiological target of the protein kinase Src.
14991669 2004 Implication of mitochondrial involvement in apoptotic activity of fragile histidine triad gene: application of synchronous luminescence spectroscopy.
14760383 2004 Fhit expression in human gastric adenomas and intramucosal carcinomas: correlation with Mlh1 expression and gastric phenotype.
14719099 2004 Altered p16INK4a and Fhit expression in carcinogenesis and progression of human oral cancer.
14719066 2004 Decreased FHIT protein expression correlates with a worse prognosis in patients with diffuse large B-cell lymphoma.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14675322 The effect of codon 98 of the FHIT gene on cervical cancer in Korean women.
14660280 5'-CpG island methylation of the FHIT gene is associated with reduced protein expression and higher clinical stage in cervical carcinomas.
14630947 2003 Fragile site orthologs FHIT/FRA3B and Fhit/Fra14A2: evolutionarily conserved but highly recombinogenic.
14569398 2004 Reduced Fhit protein expression in human malignant mesothelioma.
14566838 2003 Loss of FHIT protein expression is a marker of adverse evolution in good prognosis localized breast cancer.
12969785 2003 Expression of Fhit, Mlh1, and P53 protein in human gallbladder carcinoma.
12964015 2003 Clinical significance of Fhit expression in development of colorectal carcinoma of various macroscopic types.
12926121 Loss of Fhit protein expression in high-grade and advanced stage endometrial carcinomas.
12893195 2003 Reduced Fhit expression in cervical carcinoma: correlation with tumor progression and poor prognosis.
12890991 2003 Effect of FHIT gene replacement on growth, cell cycle and apoptosis in pancreatic cancer cells.
12839965 2003 Allele loss and promoter hypermethylation of VHL, RAR-beta, RASSF1A, and FHIT tumor suppressor genes on chromosome 3p in esophageal squamous cell carcinoma.
12833632 2003 Gelsolin and plasminogen activator inhibitor-1 are Ap3A-binding proteins.
12800227 2003 Loss of fragile histidine triad protein in human hepatocellular carcinoma.
12771912 2003 Cancer and the FRA3B/FHIT fragile locus: it's a HIT.
12698186 2003 Abnormal Fhit expression is an independent poor prognostic factor for cervical cancer.
12697969 2003 Microsatellite instability is often observed in esophageal carcinoma patients with allelic loss in the FHIT/FRA3B locus.
12627509 2003 Down-regulation of fragile histidine triad expression in prostate carcinoma.
12574506 2003 Designed FHIT alleles establish that Fhit-induced apoptosis in cancer cells is limited by substrate binding.
12529969 Loss of Msh2 is not associated with FHIT deletion in breast carcinomas.
12483524 2002 Evidence that instability within the FRA3B region extends four megabases.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12452072 2002 [Loss of fragile histidine triad expression and metastasis in breast cancer].
12419158 2002 Loss of fragile histidine triad expression in colorectal carcinoma.
12362975 2002 Abnormal FHIT gene transcript and c-myc and c-erbB2 amplification in breast cancer.
12353263 2002 Reciprocal translocations in breast tumor cell lines: cloning of a t(3;20) that targets the FHIT gene.
12231533 2002 Two-hit inactivation of FHIT by loss of heterozygosity and hypermethylation in breast cancer.
12177781 2002 Reduced Fhit expression is associated with mismatch repair deficiency in human advanced colorectal carcinoma.
12169206 MYCL1, FHIT, SPARC, p16(INK4) and TP53 genes associated to lung cancer in idiopathic pulmonary fibrosis.
12119013 2002 Hint, Fhit, and GalT: function, structure, evolution, and mechanism of three branches of the histidine triad superfamily of nucleotide hydrolases and transferases.
12095833 2002 Loss of fragile histidine triad (FHIT) expression and microsatellite instability in periocular sebaceous gland carcinoma in patients with Muir-Torre syndrome.
12048684 2002 [Effects of ectogenous FHIT gene on reversing malignant phenotype of human lung adenocarcinoma cells A549].
11788890 2002 Reduced Fhit protein expression and loss of heterozygosity at FHIT gene in tumours from smoking and asbestos-exposed lung cancer patients.
11768238 2001 Distribution of Fhit protein in rat tissues and its intracellular localization.
11517343 2001 The tumor spectrum in FHIT-deficient mice.
11396980 2001 Altered expression of the fragile histidine triad gene in primary gastric adenocarcinomas.
11320209 2001 Sequence conservation at human and mouse orthologous common fragile regions, FRA3B/FHIT and Fra14A2/Fhit.
11248081 2001 FHIT gene therapy prevents tumor development in Fhit-deficient mice.
11085938 2000 Association of FHIT (fragile histidine triad), a candidate tumour suppressor gene, with the ubiquitin-conjugating enzyme hUBC9.
11071873 2000 Frequent altered expression of fragile histidine triad protein in human colorectal adenomas.
10706123 2000 Alterations of the FHIT gene in human hepatocellular carcinoma.
9824201 1998 Study of FHIT transcripts in normal and malignant breast tissue.
9689122 1998 The hereditary renal cell carcinoma 3;8 translocation fuses FHIT to a patched-related gene, TRC8.
9671749 1998 Nitrilase and Fhit homologs are encoded as fusion proteins in Drosophila melanogaster and Caenorhabditis elegans.
9583683 1998 Molecular analysis of the FHIT gene in human prostate cancer.
9576908 1998 Genetic, biochemical, and crystallographic characterization of Fhit-substrate complexes as the active signaling form of Fhit.
9537583 1998 Analysis of FHIT transcripts in cervical and endometrial cancers.
9405656 1997 Sequence of the FRA3B common fragile region: implications for the mechanism of FHIT deletion.
9366528 1997 Aberrant splicing of the TSG101 and FHIT genes occurs frequently in multiple malignancies and in normal tissues and mimics alterations previously described in tumours.
9323207 1997 Structure-based analysis of catalysis and substrate definition in the HIT protein family.
9290949 1997 Precise localization of the FHIT gene to the common fragile site at 3p14.2 (FRA3B) and characterization of homozygous deletions within FRA3B that affect FHIT transcription in tumor cell lines.
9261067 1997 MAD analysis of FHIT, a putative human tumor suppressor from the HIT protein family.
9012482 1997 Structure and expression of the human FHIT gene in normal and tumor cells.
8988031 1997 Expression of reciprocal hybrid transcripts of HMGIC and FHIT in a pleomorphic adenoma of the parotid gland.
8824874 1996 FRA3B extends over a broad region and contains a spontaneous HPV16 integration site: direct evidence for the coincidence of viral integration sites and fragile sites.
8794732 1996 Fhit, a putative tumor suppressor in humans, is a dinucleoside 5',5"'-P1,P3-triphosphate hydrolase.
8790406 1996 FHIT gene alterations in head and neck squamous cell carcinomas.
8661111 1996 Direct cloning of DNA sequences from the common fragile site region at chromosome band 3p14.2.
8640789 1996 Potential gastrointestinal tumor suppressor locus at the 3p14.2 FRA3B site identified by homozygous deletions in tumor cell lines.
8620533 1996 The FHIT gene 3p14.2 is abnormal in lung cancer.
8598045 1996 The FHIT gene, spanning the chromosome 3p14.2 fragile site and renal carcinoma-associated t(3;8) breakpoint, is abnormal in digestive tract cancers.
6874402 1983 A new heritable fragile site on human chromosome 3.
6852828 1983 A new inducible fragile site on chromosome 3(p14.2) in human lymphocytes.
6704944 1984 Involvement of band 3p14 in t(3;8) hereditary renal carcinoma.
3864602 1985 Report of the Committee on Chromosome Rearrangements in Neoplasia and on Fragile Sites.