Property Summary

NCBI Gene PubMed Count 75
PubMed Score 216.29
PubTator Score 142.07

Knowledge Summary

Patent (52,062)

Expression

  Differential Expression (12)

Disease log2 FC p
Waldenstrons macroglobulinemia -1.036 5.5e-03
chronic lymphocytic leukemia 1.408 1.2e-03
cutaneous lupus erythematosus 1.200 9.0e-03
osteosarcoma -3.653 3.8e-05
non-small cell lung cancer -2.616 1.4e-27
lung cancer -3.300 2.4e-05
Breast cancer -2.100 3.9e-02
interstitial cystitis 1.500 1.9e-03
lung adenocarcinoma -2.200 1.0e-11
lung carcinoma -1.900 7.1e-23
mucosa-associated lymphoid tissue lympho... 1.849 1.2e-02
ulcerative colitis 1.700 3.3e-04

Protein-protein Interaction (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (8)

PMID Text
25972488 we provide evidence for involvement of HCK and FGR in FCRL4-mediated immunoregulation and for the functional importance of posttranslational modifications of the FCRL4 molecule.
24162774 HIV-1 gp120 downregulates the expression of feline Gardner-Rasheed sarcoma viral oncogene homolog (FGR) in human B cells
23896410 Data indicate that combined treatment using SFK (LYN, HCK, or FGR) and c-KIT inhibitor dasatinib dasatinib and chemotherapy provides a novel approach to increasing p53 activity and enhancing targeting of acute myeloid leukemia (AML) stem cells.
23867815 HIV-1 gp120 downregulates the expression of feline Gardner-Rasheed sarcoma viral oncogene homolog (FGR) in human B cells
21300758 Fgr plays a biologically significant role in ovarian cancer growth and might represent an important target
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17845055 Recruitment of the coactivator, SRC2, is coupled to cooperative DNA binding by the progesterone receptor.
11928806 Substitution of two relevant serines with glutamic acid residues in urokinase prevents urokinase activation of p55fgr needed for cell migration and adhesion.

AA Sequence

MGCVFCKKLEPVATAKEDAGLEGDFRSYGAADHYGPDPTKARPASSFAHIPNYSNFSSQAINPGFLDSGT      1 - 70
IRGVSGIGVTLFIALYDYEARTEDDLTFTKGEKFHILNNTEGDWWEARSLSSGKTGCIPSNYVAPVDSIQ     71 - 140
AEEWYFGKIGRKDAERQLLSPGNPQGAFLIRESETTKGAYSLSIRDWDQTRGDHVKHYKIRKLDMGGYYI    141 - 210
TTRVQFNSVQELVQHYMEVNDGLCNLLIAPCTIMKPQTLGLAKDAWEISRSSITLERRLGTGCFGDVWLG    211 - 280
TWNGSTKVAVKTLKPGTMSPKAFLEEAQVMKLLRHDKLVQLYAVVSEEPIYIVTEFMCHGSLLDFLKNPE    281 - 350
GQDLRLPQLVDMAAQVAEGMAYMERMNYIHRDLRAANILVGERLACKIADFGLARLIKDDEYNPCQGSKF    351 - 420
PIKWTAPEAALFGRFTIKSDVWSFGILLTELITKGRIPYPGMNKREVLEQVEQGYHMPCPPGCPASLYEA    421 - 490
MEQTWRLDPEERPTFEYLQSFLEDYFTSAEPQYQPGDQT                                   491 - 529
//

Text Mined References (80)

PMID Year Title
25972488 2015 Involvement of the HCK and FGR src-family kinases in FCRL4-mediated immune regulation.
24860872 2014 Analysis of 5-lipoxygenase phosphorylation on molecular level by MALDI-MS.
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
23896410 2013 The Src and c-Kit kinase inhibitor dasatinib enhances p53-mediated targeting of human acute myeloid leukemia stem cells by chemotherapeutic agents.
22939624 2012 Quantitative analysis of HSP90-client interactions reveals principles of substrate recognition.
21300758 2011 Functional roles of Src and Fgr in ovarian carcinoma.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
19369195 2009 Large-scale proteomics analysis of the human kinome.
17845055 2007 Coactivator assembly at the promoter: efficient recruitment of SRC2 is coupled to cooperative DNA binding by the progesterone receptor.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17164290 2007 Sorting of Fas ligand to secretory lysosomes is regulated by mono-ubiquitylation and phosphorylation.
16921024 2006 Differential kinase requirements in human and mouse Fc-gamma receptor phagocytosis and endocytosis.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16273093 2006 A quantitative protein interaction network for the ErbB receptors using protein microarrays.
15723811 2005 The Src family kinases Hck and Fgr negatively regulate neutrophil and dendritic cell chemokine signaling via PIR-B.
15561106 2005 The proto-oncogene Fgr regulates cell migration and this requires its plasma membrane localization.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15459198 2004 Binding of low density lipoprotein to platelet apolipoprotein E receptor 2' results in phosphorylation of p38MAPK.
15098032 2004 Requirement of Src kinases Lyn, Hck and Fgr for BCR-ABL1-induced B-lymphoblastic leukemia but not chronic myeloid leukemia.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12473651 2003 Characterization of a novel negative regulator (DOC-2/DAB2) of c-Src in normal prostatic epithelium and cancer.
12468645 2002 Expression and subcellular distribution of the active form of c-Src tyrosine kinase in differentiating human endometrial stromal cells.
12435267 2003 Fgr but not Syk tyrosine kinase is a target for beta 2 integrin-induced c-Cbl-mediated ubiquitination in adherent human neutrophils.
12387813 2002 High-affinity Src-SH2 ligands which do not activate Tyr(527)-phosphorylated Src in an experimental in vivo system.
12387730 2003 Site-specific phosphorylation of platelet focal adhesion kinase by low-density lipoprotein.
12096713 2002 Activation of Pyk2/RAFTK induces tyrosine phosphorylation of alpha-synuclein via Src-family kinases.
11928806 2002 Inhibition of receptor-dependent urokinase signaling by specific Ser to Glu substitutions.
11823534 2002 Lyn tyrosine kinase is important for IL-5-stimulated eosinophil differentiation.
11744621 2002 Multiple phosphorylation of alpha-synuclein by protein tyrosine kinase Syk prevents eosin-induced aggregation.
11672534 2001 Inhibition of beta 2 integrin receptor and Syk kinase signaling in monocytes by the Src family kinase Fgr.
11546677 2001 K-Cl cotransport modulation by intracellular Mg in erythrocytes from mice bred for low and high Mg levels.
11526478 2001 Cleavage of Fyn and Lyn in their N-terminal unique regions during induction of apoptosis: a new mechanism for Src kinase regulation.
11162638 2001 Activated Fyn phosphorylates alpha-synuclein at tyrosine residue 125.
11078731 2001 Phosphatidic acid regulates tyrosine phosphorylating activity in human neutrophils: enhancement of Fgr activity.
11071635 2000 Stem cell factor induces phosphatidylinositol 3'-kinase-dependent Lyn/Tec/Dok-1 complex formation in hematopoietic cells.
10973280 2000 Regulation of tyrosine kinase activation and granule release through beta-arrestin by CXCRI.
10861086 2000 Differential involvement of Src family kinases in Fc gamma receptor-mediated phagocytosis.
10739672 2000 Clustering of beta(2)-integrins on human neutrophils activates dual signaling pathways to PtdIns 3-kinase.
10702640 2000 Kinases of the Src family: structure and functions.
10527858 1999 Novel association of the src family kinases, hck and c-fgr, with CCR3 receptor stimulation: A possible mechanism for eotaxin-induced human eosinophil chemotaxis.
10358777 1999 The Wiskott-Aldrich syndrome protein (WASP): roles in signaling and cytoskeletal organization.
10229804 1999 CDw150 associates with src-homology 2-containing inositol phosphatase and modulates CD95-mediated apoptosis.
10080533 1999 Integrin signal transduction in myeloid leukocytes.
10066823 1999 Molecular features underlying the sequential phosphorylation of HS1 protein and its association with c-Fgr protein-tyrosine kinase.
9208935 1997 Sequence specificity of C-terminal Src kinase (CSK)--a comparison with Src-related kinases c-Fgr and Lyn.
8867673 1995 Activation of p58c-fgr and p53/56lyn in adherent human neutrophils: evidence for a role of divalent cations in regulating neutrophil adhesion and protein tyrosine kinase activities.
8824280 1996 Identification of regions of the Wiskott-Aldrich syndrome protein responsible for association with selected Src homology 3 domains.
8753773 1996 Association of CD24 with the kinase c-fgr in a small cell lung cancer cell line and with the kinase lyn in an erythroleukemia cell line.
8612628 1996 A comparative study of the phosphotyrosyl phosphatase specificity of protein phosphatase type 2A and phosphotyrosyl phosphatase type 1B using phosphopeptides and the phosphoproteins p50/HS1, c-Fgr and Lyn.
8603737 1996 Activation of SRC family kinases in human neutrophils. Evidence that p58C-FGR and p53/56LYN redistributed to a Triton X-100-insoluble cytoskeletal fraction, also enriched in the caveolar protein caveolin, display an enhanced kinase activity.
8327512 1993 Association of immunoglobulin G Fc receptor II with Src-like protein-tyrosine kinase Fgr in neutrophils.
8313462 1994 Myristylation and palmitylation of Src family members: the fats of the matter.
7812001 1995 The proto-oncogene c-fgr is expressed in normal mantle zone B lymphocytes and is developmentally regulated during myelomonocytic differentiation in vivo.
7726865 1995 Identification of a phorbol ester responsive region in the myeloid-specific promoter of the c-fgr proto-oncogene.
7721825 1995 Identification of the major tyrosine kinase substrate in signaling complexes formed after engagement of Fc gamma receptors.
7678701 1993 Phosphorylation of Src mutants at Tyr 527 in fibroblasts does not correlate with in vitro phosphorylation by CSK.
7565724 1995 Wiskott-Aldrich syndrome protein physically associates with Nck through Src homology 3 domains.
7519620 1994 Beta 2 integrin-dependent protein tyrosine phosphorylation and activation of the FGR protein tyrosine kinase in human neutrophils.
7515063 1994 Regulation of c-Fgr protein kinase by c-Src kinase (CSK) and by polycationic effectors.
3922831 1985 Human c-f gr gene does not contain coding sequence for actin-like protein.
3330776 1987 Isolation and sequencing of cDNA clones homologous to the v-fgr oncogene from a human B lymphocyte cell line, IM-9.
3275868 1988 Primary structure of the human fgr proto-oncogene product p55c-fgr.
3023853 1986 Structure, expression, and chromosomal location of the human c-fgr gene.
3003578 1986 fgr proto-oncogene mRNA induced in B lymphocytes by Epstein-Barr virus infection.
2995972 1985 Isolation and chromosomal localization of the human fgr protooncogene, a distinct member of the tyrosine kinase gene family.
2852026 1988 Structure and expression of c-fgr protooncogene mRNA in Epstein-Barr virus converted cell lines.
2581127 1985 Isolation of duplicated human c-src genes located on chromosomes 1 and 20.
2181286 1990 Specific expression of human c-fgr in natural immunity effector cells.
2154410 1990 Regulation of c-fgr proto-oncogene expression in Epstein-Barr virus infected B-cell lines.
1847500 1991 A novel c-fgr exon utilized in Epstein-Barr virus-infected B lymphocytes but not in normal monocytes.
1826268 1991 Expression of lineage-restricted protein tyrosine kinase genes in human natural killer cells.
1737799 1992 Diverse biologic properties imparted by the c-fgr proto-oncogene.
1690869 1990 Structure of the complete human c-fgr proto-oncogene and identification of multiple transcriptional start sites.
1652975 1991 The c-fgr proto-oncogene: expression in Epstein-Barr-virus-infected B lymphocytes and in cells of the myelomonocytic and granulocytic lineages.
1373875 1992 Characterization of the 5' untranslated region of the human c-fgr gene and identification of the major myelomonocytic c-fgr promoter.
1339476 1992 A polymorphic microsatellite repeat is located close to the promoter region of the c-fgr proto-oncogene (FGR) at chromosome 1p36.2-p36.1.