Property Summary

NCBI Gene PubMed Count 34
PubMed Score 99.13
PubTator Score 45.74

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (33)

Disease log2 FC p
nephrosclerosis 1.071 1.5e-03
Waldenstrons macroglobulinemia 1.490 4.0e-02
chronic lymphosyte leukemia -2.100 3.0e-05
group 4 medulloblastoma -2.000 1.5e-04
atypical teratoid/rhabdoid tumor -1.600 1.6e-04
medulloblastoma, large-cell -2.300 7.0e-05
Duchenne muscular dystrophy 2.035 1.1e-07
autosomal dominant Emery-Dreifuss muscul... 1.840 1.5e-03
juvenile dermatomyositis 1.952 9.3e-10
limb girdle muscular dystrophy 2A 1.063 1.5e-02
Atopic dermatitis -1.200 2.0e-02
adrenocortical carcinoma -1.898 1.4e-03
pancreatic ductal adenocarcinoma liver m... -1.415 2.6e-02
tuberculosis 3.000 1.4e-07
non-small cell lung cancer -1.472 2.0e-09
intraductal papillary-mucinous carcinoma... -2.600 1.1e-02
colon cancer -2.500 5.7e-03
lung cancer 1.800 1.5e-03
sarcoidosis 2.500 1.2e-02
fibroadenoma -1.200 2.2e-02
diabetes mellitus -1.200 1.6e-02
interstitial cystitis 1.200 3.5e-03
pilocytic astrocytoma 1.100 5.0e-03
primary Sjogren syndrome 1.700 1.6e-03
subependymal giant cell astrocytoma 2.503 4.5e-02
lung adenocarcinoma -1.400 1.5e-04
psoriasis -1.200 1.3e-03
lung carcinoma -2.000 2.4e-14
Breast cancer -1.300 3.0e-04
mucosa-associated lymphoid tissue lympho... 2.550 2.8e-02
ovarian cancer -3.100 1.7e-05
dermatomyositis 1.700 7.8e-03
head and neck cancer -1.400 2.9e-02

Synonym

Accession Q14314
Symbols T49
pT49

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (23)

PMID Text
25971300 Results show that FGL2 functions as a key immune-suppressive modulator and has potential as an immunotherapeutic target for treating glioblastoma multiforme (GBM).
25496996 these results suggest that FGL-2 mediates angiogenesis and tumorigenesis not by thrombin-mediated mechanism but rather through FGF-2/ERK signaling pathway.
25303152 FGL-2 prothrombinase activity in PBMC of lymphoma patients is increased in active disease and normalizes during remission, thus being a potential marker for follow up of lymphoma patients.
25129313 Studied fibrinogen-like protein 2 expression and its role in CRC metastasis and underlying molecular mechanisms; results suggest that FGL2 plays an important oncogenic role in CRC aggressiveness by inducing EMT.
24728278 The selected peptide sequence NPG-12 may be a critical domain for hfgl2 prothrombinase activity.
24287641 immunomodulatory activity of FGL2 may be involved in the immunopathogenesis of inflammatory bowel disease
23898208 HIV-1 Vif downregulates the expression of fibrinogen-like 2 (FGL2) in Vif-expression T cells
23383108 HIV-1 Vif downregulates the expression of fibrinogen-like 2 (FGL2) in Vif-expression T cells
23333304 HIV-1 Vif downregulates the expression of fibrinogen-like 2 (FGL2) in Vif-expression T cells
23195010 Serum fgl2 levels were increased among renal allograft recipients with acute rejection episodes to an extent dependent upon the pathological type and severity of the response.
22983266 Circulating fibrinogen-like protein 2 is increased in patients with systemic sclerosis.
22925132 FGL2 contributes to hepatocellular carcinoma tumour growth and angiogenesis in a thrombin-dependent manner, and downregulation of its expression might be of therapeutic significance in HCC.
22886967 The proliferation index of CD8(+)T cells after blocking FGL2 was higher.
22082274 HBV surface antigen-induced transcription of hfgl2 prothrombinase gene.
20438701 FGL2 plays an important role in macrophage activation in the lungs of COPD patients through MAPK pathway modulation.
19590927 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19423547 SARS-CoV N protein specifically modulates transcription of the FGL2 gene to cause fibrosis and vascular thrombosis.
18932275 Human fg12 contributes to the hypercoagulability in cancer and may induce tumor angiogenesis and metastasis via cytokine induction.
18801734 Hepatitis B virus-induced hFGL2 transcription is dependent on c-Ets-2 and MAPK signal pathway
18390877 fgl2 gene transcription induced by the N protein of SARS-CoV was dependent on transcription factor C/EBP alpha binding with its cognate cis-element in fgl2 promoter.
16437596 Results suggest that virus-induced fibrinogen-like protein 2 prothrombinase/fibroleukin expression and associated coagulation activity play a pivotal role in initiating severe hepatitis.
15905589 FGL2 expression may be critical to the pathogenesis of renal allograft rejection; these data provide a rationale for targeting the fgl2 gene in an attempt to modulate allograft rejection.
15490304 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKLANWYWLSSAVLATYGFLVVANNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVSLPPLTIQLPK      1 - 70
QFSRIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTGAPGEVGDNRVRELESEVNKL     71 - 140
SSELKNAKEEINVLHGRLEKLNLVNMNNIENYVDSKVANLTFVVNSLDGKCSKCPSQEQIQSRPVQHLIY    141 - 210
KDCSDYYAIGKRSSETYRVTPDPKNSSFEVYCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRR    211 - 280
EFWLGNDKIHLLTKSKEMILRIDLEDFNGVELYALYDQFYVANEFLKYRLHVGNYNGTAGDALRFNKHYN    281 - 350
HDLKFFTTPDKDNDRYPSGNCGLYYSSGWWFDACLSANLNGKYYHQKYRGVRNGIFWGTWPGVSEAHPGG    351 - 420
YKSSFKEAKMMIRPKHFKP                                                       421 - 439
//

Text Mined References (35)

PMID Year Title
25971300 2015 FGL2 as a Multimodality Regulator of Tumor-Mediated Immune Suppression and Therapeutic Target in Gliomas.
25496996 2015 The cell-membrane prothrombinase, fibrinogen-like protein 2, promotes angiogenesis and tumor development.
25303152 2014 Increased activity of cell membrane-associated prothrombinase, fibrinogen-like protein 2, in peripheral blood mononuclear cells of B-cell lymphoma patients.
25129313 2014 Overexpression of fibrinogen-like protein 2 induces epithelial-to-mesenchymal transition and promotes tumor progression in colorectal carcinoma.
24728278 2014 Novel antibody against a glutamic acid-rich human fibrinogen-like protein 2-derived peptide near Ser91 inhibits hfgl2 prothrombinase activity.
24287641 2014 Intestinal and peripheral fibrinogen-like protein 2 expression in inflammatory bowel disease.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23195010 2012 Serum level of soluble fibrinogen-like protein 2 in renal allograft recipients with acute rejection: a preliminary study.
22983266 2013 Increased circulating fibrinogen-like protein 2 in patients with systemic sclerosis.
22925132 2012 Downregulation of FGL2/prothrombinase delays HCCLM6 xenograft tumour growth and decreases tumour angiogenesis.
22886967 2012 Inhibitory function of Tregs via soluble FGL2 in chronic hepatitis B.
22082274 2011 Antiviral resistance mutations potentiate HBV surface antigen-induced transcription of hfgl2 prothrombinase gene.
20438701 2010 The FGL2/fibroleukin prothrombinase is involved in alveolar macrophage activation in COPD through the MAPK pathway.
19590927 2010 Candidate genes associated with susceptibility for SARS-coronavirus.
19423547 2009 Severe acute respiratory syndrome coronavirus nucleocapsid protein does not modulate transcription of the human FGL2 gene.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18932275 2008 Fibrinogen-like protein 2/fibroleukin prothrombinase contributes to tumor hypercoagulability via IL-2 and IFN-gamma.
18801734 2008 Hepatitis B virus-induced hFGL2 transcription is dependent on c-Ets-2 and MAPK signal pathway.
18390877 2008 The nucleocapsid protein of SARS-CoV induces transcription of hfgl2 prothrombinase gene dependent on C/EBP alpha.
16437596 2005 Fibrinogen-like protein 2 fibroleukin expression and its correlation with disease progression in murine hepatitis virus type 3-induced fulminant hepatitis and in patients with severe viral hepatitis B.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
15905589 2005 Role of fibrinogen-like protein 2 prothrombinase/fibroleukin in experimental and human allograft rejection.
15490304 2004 Large-scale investigation of genomic markers for severe periodontitis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12690205 2003 Human chromosome 7: DNA sequence and biology.
12624729 2003 Identification of a novel human angiopoietin-like gene expressed mainly in heart.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11170750 2001 Genomic characterization, localization, and functional expression of FGL2, the human gene encoding fibroleukin: a novel human procoagulant.
9647217 1998 Characterization of human fibroleukin, a fibrinogen-like protein secreted by T lymphocytes.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7642106 1995 Sequence of a human transcript expressed in T-lymphocytes and encoding a fibrinogen-like protein.
1602151 1992 Treatment of Haemophilus aphrophilus endocarditis with ciprofloxacin.