Property Summary

NCBI Gene PubMed Count 22
PubMed Score 26.44
PubTator Score 17.00

Knowledge Summary

Patent

No data available

Expression

Gene RIF (15)

AA Sequence

MAKVFSFILVTTALTMGREISALEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENT      1 - 70
VIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDY     71 - 140
ENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGT    141 - 210
AGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTD    211 - 280
NGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI                                          281 - 312
//

Text Mined References (25)

PMID Year Title