Property Summary

NCBI Gene PubMed Count 18
PubMed Score 10.44
PubTator Score 6.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
acute quadriplegic myopathy 1.301 8.5e-05
group 4 medulloblastoma -1.100 8.1e-05
inflammatory breast cancer -1.500 1.3e-03
interstitial cystitis -1.700 2.6e-03
malignant mesothelioma -1.900 3.0e-07
pancreatic ductal adenocarcinoma liver m... -2.006 2.2e-03
urothelial carcinoma -1.200 1.1e-03

Gene RIF (12)

AA Sequence

MSGGEQKPERYYVGVDVGTGSVRAALVDQSGVLLAFADQPIKNWEPQFNHHEQSSEDIWAACCVVTKKVV      1 - 70
QGIDLNQIRGLGFDATCSLVVLDKQFHPLPVNQEGDSHRNVIMWLDHRAVSQVNRINETKHSVLQYVGGV     71 - 140
MSVEMQAPKLLWLKENLREICWDKAGHFFDLPDFLSWKATGVTARSLCSLVCKWTYSAEKGWDDSFWKMI    141 - 210
GLEDFVADNYSKIGNQVLPPGASLGNGLTPEAARDLGLLPGIAVAASLIDAHAGGLGVIGADVRGHGLIC    211 - 280
EGQPVTSRLAVICGTSSCHMGISKDPIFVPGVWGPYFSAMVPGFWLNEGGQSVTGKLIDHMVQGHAAFPE    281 - 350
LQVKATARCQSIYAYLNSHLDLIKKAQPVGFLTVDLHVWPDFHGNRSPLADLTLKGMVTGLKLSQDLDDL    351 - 420
AILYLATVQAIALGTRFIIEAMEAAGHSISTLFLCGGLSKNPLFVQMHADITGMPVVLSQEVESVLVGAA    421 - 490
VLGACASGDFASVQEAMAKMSKVGKVVFPRLQDKKYYDKKYQVFLKLVEHQKEYLAIMNDD             491 - 551
//

Text Mined References (20)

PMID Year Title