Property Summary

NCBI Gene PubMed Count 259
PubMed Score 151.20
PubTator Score 163.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -2.262 2.7e-02
non-small cell lung cancer -1.975 2.5e-03
lung cancer -5.500 7.0e-07
sarcoidosis -3.500 3.6e-02
cystic fibrosis 1.400 6.4e-03
aldosterone-producing adenoma -2.854 3.2e-02
lung carcinoma -2.400 4.7e-04

 GWAS Trait (1)

Gene RIF (159)

PMID Text
27060305 5877G>A mutation in the exon 8 of the FGG gene is underlies the pathogenesis of congenital dysfibrinogenemia in a Chinese family.
27044366 Neutrophilic asthma patients and eosinophilic asthma patients had increased fibrinogen compared to controls.
26663050 Data indicate that mutations of the fibrinogen (Fg) gene seem to aggregate to the D region of fibrinogen gamma chain (FGG)
26608329 Thrombin and fibrinogen gamma' regulate protofibril packing within fibrin fibers and thereby influence clot stiffness.
26494231 Suggest gamma' fibrinogen concentrations reflect general inflammation that accompanies and may contribute to atherosclerotic CVD, instead of gamma' fibrinogen being a causal risk factor.
26039544 Case Reports: clustering of mutations causing fibrinogen storage disease in the fibrinogen gamma chain between residues 284 and 375.
26037343 A novel mutation in FGG gene is associated with congenital hypofibrinogenemia.
25982359 congenital dysfibrinogenemia with a novel mutation in fibrinogen gamma chain (gamma322 Phe-->Ile, Fibrinogen Beijing) and haemophilia B in a family
25896761 This study presents the covalent structure of single-stranded fibrin oligomers cross-linked by FXIIIa.
25788521 Low FI levels are strongly associated with rare CFI variants and age-related macular degeneration.
25688462 This study shows that homocysteine influences blood clot properties alone and in combination with total fibrinogen but not with fibrinogen gamma' isoform in Africans.
25614284 Report role of gamma'-fibrinogen in control of hemostatic clot growth in the venous circulation.
25588350 Letter/Case Report: FGG 339CysSer mutation causes only hypofibrinogenaemia. Accompanying functionality change is due to increased sialylation and inheritance of the B448Lys allele.
25551304 investigated molecular basis of dysfibrinogenaemia in a Chinese pedigree; sequencing results of proband revealed a novel heterozygous IVS9+1delG mutation of FGG gene; same results were found in her mother sister and daughter; concluded the mutation is responsible for the proband's dysfibrinogenaemia
25413489 the NGR motif in fibrinogen is the site that is primarily responsible for the interaction with resting alphaIIbbeta3 and is responsible for triggering platelet activation
25296580 Data indicate that leptin receptor gene (LEPR) single-nucleotide polymorphisms (SNPs) rs4291477 significantly associated with serum fibrinogen.
25280629 Results show that oxidized fibrinogen, instead of serum albumin (HSA), is the key protein for intermolecular dityrosine formation in plasma.
25213709 Final clot structure may contribute to increased cardiovascular disease (CVD) risk in vivo through associations with other CVD risk factors independent from total or gamma' fibrinogen concentration.
25128532 Reduced plasminogen binding and delayed activation render gamma'-fibrin more resistant to lysis than gammaA-fibrin.
25074738 While the gamma Ser313Gly mutation manifested as dysfibrinogenemia with a thrombotic background, the gamma Phe204Val mutation manifested as hypofibrinogenemia without clinical symptoms.
25042726 Letter/Case Report: FGG 320Asp-Glu substitution that displayed both a quantitative and functional defect and presented as hypodysfibrinogenaemia.
24951429 observed increased APC resistance in carriers of fibrinogen gamma gene (FGG) haplotype 2, which is associated with reduced levels of the alternatively spliced fibrinogen gamma' chain. We then studied the effects of fibrinogen and its gamma' chain on APC resistance.
24916154 elevated levels of gammaA/gammaA fibrinogen promote arterial thrombosis in vivo, whereas gammaA/gamma' does not
24914742 Novel fibrinogen mutations (gammaTrp208Leu and gammaLys232Thr) leading to congenital hypofibrinogenemia in two unrelated Chinese families have been described.
24803720 Plasma fibrinogen is an independent predictor for the severity of coronary artery disease in diabetic patients.
24791650 Exploratory multilocus polygenic analyses with p <0.05 showed an association of optimism with SNPs in MAOA, IL10, and FGG genes, and an association of resilience with a SNP in MAOA.
24556703 A heterozygous point mutation located in exon 3 of the FGG gene c.140C>T (p.Thr21Ile)was found in a patient and her mother, both of whom had hypofibrinogenemia.
24352576 novel causitive mutation is identified in a New Zealand family with hypofibrinogenaemia
24040290 Stepwise assembly of fibrinogen is assisted by the endoplasmic reticulum ERp57 lectin-chaperone system in a human hepatocyte cell line.
24011387 report of 2 hypofibrinogenemias, Shizuoka III and Kanazawa II, caused by heterozygous nonsense mutation at the fibrinogen gamma-chain, gamma23X and gamma376X, respectively; analysis demonstrated the transcribed aberrant mRNAs from both gamma23X and gamma376X genes are degraded by nonsense-mediated mRNA decay and not translated to the truncated polypeptide
23995838 Data indicate that the adhesive alpha-granule proteins fibrinogen and thrombospondin are concentrated in a fibrin polymerization-dependent "cap" on phosphatidylserine-expressing platelets that promotes their incorporation into thrombi.
23990470 Results indicate that the alphaC domain of fibrinogen harbors a Zn(2+)-dependent heparin binding site.
23969696 We identify 23 robustly associated fibrinogen loci, 15 of which are new, but no support for a causal relationship between circulating levels of fibrinogen and coronary artery disease, stroke, or venous thromboembolism.
23877568 These results indicate that DPT can modify certain biological functions of fibrin, and thus a another function of this extracellular matrix protein was revealed.
23852822 Studies indicate that in afibrinogenemia and hypofibrinogenemia, most mutations of the FGA, FGB, or FGG fibrinogen encoding genes are null mutations.
23645504 A decreased number of factor XIIIa+ cells is found in the lower dermis following pulsed dye laser treatment.
23492915 A novel FGG mutation is associated with hypofibrinogenemia.
23422752 Clot lysis time showed a stronger relationship with fibrinogen gamma' than with total fibrinogen, whereby increased fibrinogen gamma' delayed clot lysis.
23385359 9 different proteins (haptoglobin, transthyretin, apolipoprotein A-1, serum amyloid P component, apolipoprotein E, complement factor H, fibrinogen gamma, thrombin, complement C3) were identified as a potential diagnostic pattern of Parkinson's disease.
23348147 Letter/Case Report: deep vein thrombosis associated with novel substitution (gamma346Gly-->Val) at an absolutely conserved site in the fibrinogen gamma chain.
23306717 fibrinogen gamma' may contribute to the development of portal vein thrombosis
23061815 Patients with heritable dysfibrinogenaemia and harbouring a candidate single nucleotide variations within highly restricted regions of the FGN genes had similar laboratory features irrespective of genotype.
23056168 Data indicate that PDGF enhances the adhesion of CD44v-coated beads to immobilized fibrin(ogen).
23036532 HepG2 cell gamma' fibrinogen is disproportionately up-regulated by inflammatory responses induced by interleukin-6.
22836683 Regulation of the fibrinogen genes from proximal promoters and enhancers, the influence of acute-phase stimulation, post-transcriptional regulation by miRNAs and functional regulatory variants identified in genetic studies. Review.
22760446 A novel congenital Fibrinogen Melbourne hypodysfibrinogenemia caused by g326Cys-Phe in the fibrinogen gamma chain, presenting as massive splanchnic venous thrombosis, has been described in one patient and his asymptomatic father.
22489912 Impaired lung function is a correlate of fibrinogen levels and the presence of higher fibrinogen levels increases the risk of mortality both in the overall population and among subjects with COPD.
22463367 Fibrinogen gamma' is associated with the formation of mechanically weaker, non-uniform clots composed of thin fibers. This is caused by direct disruption of protofibril formation by gamma'.
22437918 Fibrinogen residue gammaAla341 is important for the proper conformation of the gamma-module, maintaining calcium-binding site and 'A-a' interactions.
22078561 mechanical unraveling of fibrin(ogen) is determined by the combined molecular transitions that couple stepwise unfolding of the gamma chain nodules and reversible extension-contraction of the alpha-helical coiled-coil connectors
21757653 gamma' fibrinogen is associated with prevalent cardiovascular disease and with SNPs exclusively in and near the fibrinogen gene locus.
21694469 Data show that D-dimer and factor VIII may be used as yardstick for systemic adjuvant therapy in node negative < 1 cm breast cancer.
21174007 potential biomarker for assessing a patient's inflammatory state and associated cardiovascular disease risk
21057694 Case Report: describe an unusual double mutation at adjacent codons in fibrinogen gamma chain associated with hypodysfibrinogenemia.
20981788 Hepatitis B spliced protein (HBSP) interacts with fibrinogen gamma chain (FGG) and inhibits fibrin polymerization and factor XIIIa-mediated fibrin cross-linking.
20838743 Letter: Substitution (gamma335Trp-->Arg) in fibrinogen Fremantle causes diminished gamma chain expression and increased sialic acid content.
20709368 In a multivariate logistic regression analysis including age, sex, smoking, diabetes, arterial hypertension and hypercholesterolemia, the FGG 10034 T variant was not significantly associated with the presence of Peripheral Arterial Disease.
20709368 Observational study of gene-disease association. (HuGE Navigator)
20666993 Case Report: describe only the fourth mutation to be identified, gamma314Thr-->Pro (fibrinogen AI duPont), giving rise to hypofibrinogenaemia and hepatic fibrinogen storage disease.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20589319 Report hypofibrinogenaemia, Matsumoto VII (M-VII), caused by a heterozygous nucleotide deletion/frameshift mutation, resulting in amino acid substitutions, late termination of translation and introduction of a canonical glycosylation site.
20508898 Letter: Polish carriers of fibrinogen gammaArg275His mutation (fibrinogen Zabrze) have relatively dense and poorly lysable fibrin clots.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20167083 Observational study of gene-disease association. (HuGE Navigator)
20128871 Observational study of gene-disease association. (HuGE Navigator)
20059469 Although IL-6 responsive binding sites are present in fibrinogen gene promoter regions, we did not find strong evidence of interaction between fibrinogen SNPs and IL6 SNPs or levels influencing CVD.
20059469 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19923982 The frequency of hemostatic clinical and laboratory anomalies at presentation of probands from unrelated families with fibrinogen structural defects due to mutations gamma A357T, gamma318-319 del, or gamma M310T were determined.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19687509 Associations of gammaA/gamma' fibrinogen levels with arterial and venous thrombosis have been reported, indicating that the functional effects of gammaA/gamma' fibrinogen may contribute to the pathology of thrombosis. Review.
19650644 Stable protofibrils cannot assemble from fibrinogen gamma asparagine308lysine monomers that lead to impaired polymerization in patients associated with dysfibrinogenemia.
19515723 FGA-H1 and FGG-H2 variants are associated with an increased risk of deep vein thrombosis and thromboembolism in children
19515723 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19492150 3'-end polymorphisms are associated with risk of venous thromboembolism in the Caucasian but not in African-American populations
19492150 Observational study of gene-disease association. (HuGE Navigator)
19412134 Observational study of gene-disease association. (HuGE Navigator)
19404553 Fibrinogen Krakow: a novel hypo/dysfibrinogenemia mutation in fibrinogen gamma chain (Asn325Ile) affecting fibrin clot structure and function. (Case report)
19332210 We found significant associations between certain candidate genetic polymorphisms and baseline plasma levels of FGB, homocysteine, and ICAM-1 in women from various race/ethnic groups.
19190816 Observational study of gene-disease association. (HuGE Navigator)
19122172 Fibrinogen-gamma C-terminal fragments induce endothelial barrier dysfunction and microvascular leak via integrin-mediated and RhoA-dependent mechanism.
19059206 These studies demonstrate the chaperone-like activity of fibrinogen.
19034331 High C reactive protein and high serum fibrinogen provide prognostic information in chronic kidney disease patients.
18989528 gammaA/gamma' fibrinogen inhibits thrombin-induced platelet aggregation.
18983496 hu-gamma' chain-containing fibrinogen is a thrombosis risk modifier
18974842 Observational study of gene-disease association. (HuGE Navigator)
18848323 Observational study of gene-disease association. (HuGE Navigator)
18842294 Observational study of gene-disease association. (HuGE Navigator)
18832913 Genetic analysis of the fibrinogen genes revealed a novel missense mutation in exon 8 of fibrinogen gamma-chain gene (FGG): c.1031A>T, p.Asp344Val (p.Asp318Val in the mature chain) in heterozygosity.
18779330 fibrinogen gamma' chain binds with high affinity to thrombin and inhibits with combined mechanisms the platelet response to thrombin
18772067 tested single nucleotide polymorphisms showed no significant association with fibrinogen levels
18772067 Observational study of gene-disease association. (HuGE Navigator)
18690352 risk of ischemic stroke was higher in FGG + FGA H3 than in H1 haplotype
18690352 Observational study of gene-disease association. (HuGE Navigator)
18676163 Study reports the mutational screening of two unrelated hypofibrinogenemic patients leading to the identification of two missense mutations, one hitherto unknown (alphaCys45Phe), and one previously described (gammaAsn345Ser).
18567199 Genetic variation in the promoter region of the beta-fibrinogen gene is associated with ischemic stroke.
18331453 FGG/FGA haplotypes may have a role in ischemic stroke
18331453 Observational study of gene-disease association. (HuGE Navigator)
18278190 While fibrinogen genetic variation was strongly associated with fibrinogen levels, there was less evidence of association with the more complex outcomes of cardiovascular disease.
18278190 Observational study of gene-disease association. (HuGE Navigator)
18239174 Fibrinogen gamma'/total fibrinogen ratio is associated with ischemic stroke, especially in acute phase. Fibrinogen gamma gene-H3 haplotype appears to be protective against ischemic stroke.
18239174 Observational study of gene-disease association. (HuGE Navigator)
18208536 The FGG-10034 C/T variant was associated with approximately 20% higher plasma D-dimer levels in European Americans.
18202324 examined the association of haplotypes in the 50-kb fibrinogen gene region with myocardial infarction in 2 large case-control samples
18202324 Observational study of gene-disease association. (HuGE Navigator)
18000621 HETEROZGOUS POINT MUTATIONS IN BOTH THE FGG AND FGB CHAINS OF FIBRINOGEN CAUSING HYPOFIBRINOGENEMIA IN FAMILY MEMBERS
17956865 an IL-6-inducible STAT3 and CDK9 binding to the proximal gamma-FBG promoter as well as increased loading of RNA Pol II
17951283 Results provide evidence for an association of common variation in the FGG and FGA genes with cerebral SVD.
17949478 RNAi-mediated knockdown of FGG expression indicated that endogenously synthesized fibrinogen promotes the growth of lung and prostate cancer cells through interaction with FGF-2.
17938819 fibrinogen Leipzig II (gamma351Gly-->Ser and gamma82Ala-->Gly) may have a role in two different molecular defects in the same polypeptide chain, the hypodysfibrinogemaemia phenotype [case report]
17883696 the molecular defect in fibrinogen Angers results in an impaired assembly and causes defective secretion and hepatic storage of fibrinogen [case report]
17854317 identification of a novel transvertion within FGG intron 6 (IVS6-320A-->T); in-frame inclusion of a 75-bp pseudo-exon carrying a premature stop was found, representing the first report of pseudo-exon activation as a mechanism leading to afibrinogenaemia
17849064 Identify fibrinogen gamma mutations in patients evaluated for hypofibrinogenemia.
17827388 Observational study of gene-disease association. (HuGE Navigator)
17688324 The peptides GPRPam and GPRPYam, which are surrogate A-knobs, were tested for their influence on fibrin polymerization with fibrinogen from lamprey and humans.
17650452 the identification of a novel point mutation gammaG200V (fibrinogen Columbus) causing hypofibrinogenemia and co-segregating with three genetic thrombophilia risk factors
17591786 The A alpha and B beta chains of fibrinogen, but not the gamma chains, are specifically recognized by Treponema denticola ATCC 35405.
17565664 These findings suggest that the CSF level of fibrinogen gamma-A chain precursor may be a candidate biomarker for AD.
17543500 These results indicate that expression of the gamma-fibrinogen gene is mainly controlled by the strength of late phase STAT3 activation, which in turn is negatively regulated by the extent of interleukin-1beta-mediated NF-kappaB activity.
17445871 Observational study of gene-disease association. (HuGE Navigator)
17445871 homozygosity for the FGG 10034 TT genotype yielded an odds ratio of 2.01, confirming the primary finding that the FGG 10034C>T polymorphism is associated with DVT risk
17403086 it is proposed that the 10034C>T change is the functional variation in FGG-H2 that is responsible for the reduction in the fibrinogen gamma'/total fibrinogen ratio and the increased deep-venous thrombosis risk
17264959 Observational study of gene-disease association. (HuGE Navigator)
17263791 Observational study of gene-disease association. (HuGE Navigator)
17241179 Observational study of gene-disease association. (HuGE Navigator)
17018627 Fibrinogen gamma C & its truncation mutant ( gamma C399tr), with a deletion of the COOH-terminal 12 residues, induced apoptosis of endothelial cells. The EC-binding determinant is cryptic in native fibrinogen but exposed in gamma C & gamma C399tr.
16940416 Both desA-fibrin with exposed A-knobs and desB-fibrin bearing B-knobs interacted with fragment D from the gammaD364H fibrinogen containing b-holes but no functional a-holes.
16928957 Flow induced alpha2beta1 activation in cells on collagen, but not on fibronectin or fibrinogen. Conversely, alpha5beta1 and alphavbeta3 are activated on fibronectin and fibrinogen, but not collagen.
16706972 Observational study of gene-disease association. (HuGE Navigator)
16705085 The degree of lateral aggregation of protofibrils into fibrin fibers was slightly reduced for gamma387Arg and Ala, and moderately reduced for gamma387Leu and Met.
16614319 Observational study of gene-disease association. (HuGE Navigator)
16525568 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16524883 there are tissue-specific differences in IL-6-receptor-gp130-coupled signaling which limit the extent of Stat3 activation and gammaFBG expression during lung inflammation
16420584 Haplotypes of the fibrinogen gamma gene do not affect the risk of myocardial infarction.
16363805 Results identify the gamma370-381 sequence of fibrin(ogen) as the binding site for alpha(IIb)beta3 involved in platelet adhesion and clot retraction and define the new recognition specificity of this integrin.
16144795 Observational study of gene-disease association. (HuGE Navigator)
16144795 Fibrinogen gamma' contains a unique high-affinity, nonsubstrate binding site for thrombin, which seems critical for the expression of the antithrombin activity
16141000 Current analysis of fibrinogen Bratislava indicates that the domains important for the processes of hexamer assembly and hexamer secretion should not be considered as strictly restricted to one or other fibrinogen chain.
16113784 analysis of gammaAsn319, Asp320 deletion variant fibrinogen
16051597 the engagement of alphaIIb beta3 by the C-terminal sequence of the fibrinogen gamma-chain initiates signals that suppress subsequent fibronectin assembly by spread platelets
15795540 Observational study of genotype prevalence. (HuGE Navigator)
15773976 data indicate that human Fibrinogen bound to Streptococcus pyogenes M5 protein promotes phagocytosis resistance by inhibiting complement deposition via the classical pathway
15735812 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15671034 the basal expression of gamma-fibrinogen is regulated by a constitutive transcriptional repressor protein, hnRNP A1, and the decreased binding activity of hnRNP A1 leads to the overexpression of gamma chain in HepG2 cells that overexpress the Bbeta chain
15641787 The central domain of the fibrinogen gamma-chain contains a novel integrin alpha M beta 2-binding sequence, which is localized within the gamma chain 228-253 region.
15632207 T>C transition in exon 9 resulting in a serine-to-proline substitution near the gamma chain C-terminus (S378P) is associated with fibrinogen Philadelphia
15583736 gamma289 is an important determinant of plasma fibrinogen levels
15311153 Tissue plasminogen activator binding to all variant fibrins was weaker than binding to normal fibrin: 2.5-fold for gamma K321A, seven-fold for gamma D320A and 10-fold for gamma D316A and gamma D318A.
15304042 an amino acid substitution of gamma 275Arg alone disrupts D:D interactions in thrombin-catalyzed fibrin polymerization and the formation of fibrin bundles and fibrin clots
15284111 in congenital afibrinogenemia, the FGG Arg134Xaa codon, which is encoded by adjacent exons (TG-intron 4-A) affected neither mRNA splicing nor stability, but led to the production of an unstable, severely truncated fibrinogen gamma
15217804 Review. Genetic and environmental factors alter fibrin structure and function. This has implications for the clinical presentation of vascular disease.
14764520 substitution of Asn308 with a hydrophobic residue altered neither polymer formation nor polymer structure at physiologic calcium concentrations, whereas substitution with lysine altered both.
14691567 the C-terminal sequences of the beta and gamma chains of fibrinogen have roles in fibrin polymerization as well as in cell attachment
12900415 fibrinogen gamma has a role in stat3 transactivation via IL-6 response elements
12871494 Fibrinogen gamma chain functions. Review.
12663453 Rates of fibrinopeptide B release from gammaA/gamma' fibrinogen were low & associated with delayed lateral aggregation of protofibrils. GammaA/gamma' clots consisted of small-diameter fibers & high numbers of branch points.
12617173 review of details of the structure, binding interactions, and function of each of the fibrinogen chains, FGA, FGB, FGG
11748101 Meta-analysis of gene-disease association. (HuGE Navigator)
11562340 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)

AA Sequence

MSWSLHPRNLILYFYALLFLSSTCVAYVATRDNCCILDERFGSYCPTTCGIADFLSTYQTKVDKDLQSLE      1 - 70
DILHQVENKTSEVKQLIKAIQLTYNPDESSKPNMIDAATLKSRKMLEEIMKYEASILTHDSSIRYLQEIY     71 - 140
NSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEI    141 - 210
DGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWN    211 - 280
GRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEG    281 - 350
NCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTI    351 - 420
GEGQQHHLGGAKQVRPEHPAETEYDSLYPEDDL                                         421 - 453
//

Text Mined References (270)

PMID Year Title
27060305 2016 [Analysis of a family with congenital dysfibrinogenemia caused by an Arg275His mutation in the gamma chain of fibrinogen].
27044366 2016 Detailed analysis of sputum and systemic inflammation in asthma phenotypes: are paucigranulocytic asthmatics really non-inflammatory?
26663050 2015 [Analysis of molecular pathogenesis and clinical phenotypes in 10 probands with inherited fibrinogen deficiency].
26627825 2016 Extracellular Fibrinogen-binding Protein (Efb) from Staphylococcus aureus Inhibits the Formation of Platelet-Leukocyte Complexes.
26608329 2016 Thrombin and fibrinogen ?' impact clot structure by marked effects on intrafibrillar structure and protofibril packing.
26494231 2015 Association of Plasma ?' Fibrinogen With Incident Cardiovascular Disease: The Atherosclerosis Risk in Communities (ARIC) Study.
26176881 2015 Fibrinogen storage disease and cirrhosis associated with hypobetalipoproteinemia owing to fibrinogen Aguadilla in a Turkish child.
26148065 2015 Specific Inflammatory Stimuli Lead to Distinct Platelet Responses in Mice and Humans.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
26039544 2015 Hepatic fibrinogen storage disease: identification of two novel mutations (p.Asp316Asn, fibrinogen Pisa and p.Gly366Ser, fibrinogen Beograd) impacting on the fibrinogen ?-module.
26037343 2015 [Congenital hypofibrinogenemia associated with a novel mutation in FGG gene].
26006300 2015 Molecular characterization of 7 patients affected by dys- or hypo-dysfibrinogenemia: Identification of a novel mutation in the fibrinogen Bbeta chain causing a gain of glycosylation.
25990487 2015 Hypofibrinogenemia and liver disease: a new case of Aguadilla fibrinogen and review of the literature.
25982359 2015 Coexisting congenital dysfibrinogenemia with a novel mutation in fibrinogen ? chain (?322 Phe?Ile, Fibrinogen Beijing) and haemophilia B in a family.
25981141 2015 Congenital hypofibrinogenemia associated with novel homozygous fibrinogen A? and heterozygous B? chain mutations.
25896761 2015 Covalent structure of single-stranded fibrin oligomers cross-linked by FXIIIa.
25828970 2015 Two symptomatic cases of dysfibrinogenemia in China: one with gamma-chain Arg275Cys mutation and another without detectable mutation in fibrinogen genes.
25816717 2015 Dysfibrinogenemia: from molecular anomalies to clinical manifestations and management.
25788521 2015 Rare genetic variants in the CFI gene are associated with advanced age-related macular degeneration and commonly result in reduced serum factor I levels.
25688462 2015 Homocysteine influences blood clot properties alone and in combination with total fibrinogen but not with fibrinogen ?' in Africans.
25614284 2015 Fibrin, ?'-fibrinogen, and transclot pressure gradient control hemostatic clot growth during human blood flow over a collagen/tissue factor wound.
25592583 2015 Identification of gene-gene and gene-environment interactions within the fibrinogen gene cluster for fibrinogen levels in three ethnically diverse populations.
25588350 2015 Novel FGG variant (?339C?S) confirms importance of the ?326-339 disulphide bond for plasma expression of newly synthesised fibrinogen.
25551304 2015 Identification of a novel splicing mutation in the fibrinogen gamma chain gene leading to dysfibrinogenaemia in a Chinese pedigree.
25427968 2015 Clinical and molecular characterisation of 21 patients affected by quantitative fibrinogen deficiency.
25413489 2015 A novel role for the fibrinogen Asn-Gly-Arg (NGR) motif in platelet function.
25296580 2014 Novel locus for fibrinogen in 3' region of LEPR gene in island population of Vis (Croatia).
25280629 2015 A central role for intermolecular dityrosine cross-linking of fibrinogen in high molecular weight advanced oxidation protein product (AOPP) formation.
25213709 2014 CVD risk factors are related to plasma fibrin clot properties independent of total and or ?' fibrinogen concentration.
25156046 2015 Genetic polymorphisms influencing total and ?' fibrinogen levels and fibrin clot properties in Africans.
25128532 2014 Reduced plasminogen binding and delayed activation render ?'-fibrin more resistant to lysis than ?A-fibrin.
25074738 2014 Two novel mutations in the fibrinogen ? nodule.
25042726 2014 Functionally compromised FGG variant (?320Asp?Glu) expressed at low level in plasma fibrinogen.
24951429 2014 Fibrinogen ?' increases the sensitivity to activated protein C in normal and factor V Leiden plasma.
24916154 2014 The fibrinogen ?A/?' isoform does not promote acute arterial thrombosis in mice.
24914742 2014 Novel mutations (?Trp208Leu and ?Lys232Thr) leading to congenital hypofibrinogenemia in two unrelated Chinese families.
24803720 2014 Association of fibrinogen with severity of stable coronary artery disease in patients with type 2 diabetic mellitus.
24791650 2014 Candidate SNP associations of optimism and resilience in older adults: exploratory study of 935 community-dwelling adults.
24556703 2014 Abnormal fibrinogen Zlín (?Thr21Ile) with missense mutation causing hypofibrinogenemia.
24513323 2013 Fibrinogen Hangzhou: congenital dysfibrinogenemia caused by the novel missense mutation in FGG (?308Asn?Thr).
24482809 2014 Fibrinogen Hangzhou: congenital dysfibrinogenemia caused by the novel missense mutation in FGG (?308Asn?Thr).
24352576 2014 Benign FGB (148Lys?Asn, and 448Arg?Lys), and novel causative ?211Tyr?His mutation distinguished by time of flight mass spectrometry in a family with hypofibrinogenaemia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24041635 2013 The role of fibrin matrices and tissue factor in early-term trophoblast proliferation and spreading.
24040290 2013 Stepwise assembly of fibrinogen is assisted by the endoplasmic reticulum lectin-chaperone system in HepG2 cells.
24011387 2013 Nonsense-mediated mRNA decay was demonstrated in two hypofibrinogenemias caused by heterozygous nonsense mutations of FGG, Shizuoka III and Kanazawa II.
23995838 2013 Procoagulant platelets form an ?-granule protein-covered "cap" on their surface that promotes their attachment to aggregates.
23990470 2013 Zn2+ mediates high affinity binding of heparin to the ?C domain of fibrinogen.
23969696 2013 Multiethnic meta-analysis of genome-wide association studies in >100 000 subjects identifies 23 fibrinogen-associated Loci but no strong evidence of a causal association between circulating fibrinogen and cardiovascular disease.
23877568 2014 Dermatopontin regulates fibrin formation and its biological activity.
23852822 2013 Congenital fibrinogen disorders: an update.
23650146 2013 A genome-wide association study for venous thromboembolism: the extended cohorts for heart and aging research in genomic epidemiology (CHARGE) consortium.
23645504 2013 Pulsed dye laser in the treatment of localized scleroderma and its effects on CD34+ and factor XIIIa+ cells: an immunohistochemical study.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23492915 2013 A novel fibrinogen mutation (? Thr277Arg) causes hereditary hypofibrinogenemia in a Chinese family.
23422752 2013 Evidence that fibrinogen ?' regulates plasma clot structure and lysis and relationship to cardiovascular risk factors in black Africans.
23385359 2013 Parkinson's disease plasma biomarkers: an automated literature analysis followed by experimental validation.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23348147 2013 Thrombosis in association with a novel substitution (?346Gly?Val) at an absolutely conserved site in the fibrinogen ? chain.
23306717 2013 Fibrinogen ?' and variation in fibrinogen gamma genes in the etiology of portal vein thrombosis.
23061815 2013 Clinical phenotype, laboratory features and genotype of 35 patients with heritable dysfibrinogenaemia.
23056168 2012 PDGF suppresses the sulfation of CD44v and potentiates CD44v-mediated binding of colon carcinoma cells to fibrin under flow.
23036532 2013 Differential regulation of fibrinogen ? chain splice isoforms by interleukin-6.
22836683 2012 Fibrinogen gene regulation.
22760446 2012 Fibrinogen Melbourne: a novel congenital hypodysfibrinogenemia caused by ?326Cys-Phe in the fibrinogen ? chain, presenting as massive splanchnic venous thrombosis.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22489912 2012 Fibrinogen, COPD and mortality in a nationally representative U.S. cohort.
22463367 2012 Evidence that fibrinogen ?' directly interferes with protofibril growth: implications for fibrin structure and clot stiffness.
22437918 2012 Fibrinogen residue ?Ala341 is necessary for calcium binding and 'A-a' interactions.
22078561 2011 Mechanism of fibrin(ogen) forced unfolding.
21980494 2011 Genetics of venous thrombosis: insights from a new genome wide association study.
21757653 2011 Assessment of genetic determinants of the association of ?' fibrinogen in relation to cardiovascular disease.
21694469 2010 Correlation of D dimer and factor VIII levels with histopathology in patients with breast carcinoma.
21502573 2011 Genetic predictors of fibrin D-dimer levels in healthy adults.
21269460 2011 Initial characterization of the human central proteome.
21174007 2011 Association between ?' fibrinogen levels and inflammation.
21057694 2011 Adjacent substitutions (?352Gly?Cys and 353Thr?Pro) in fibrinogen Ilam cause diminished ? chain expression.
20981788 2010 Hepatitis B spliced protein (HBSP) generated by a spliced hepatitis B virus RNA participates in abnormality of fibrin formation and functions by binding to fibrinogen ? chain.
20838743 2010 Substitution (?335Trp?Arg) in fibrinogen Fremantle causes diminished ? chain expression and increased sialic acid content.
20709368 2010 The fibrinogen gamma 10034C>T polymorphism is not associated with Peripheral Arterial Disease.
20666993 2010 Novel fibrinogen mutation ?314Thr?Pro (fibrinogen AI duPont) associated with hepatic fibrinogen storage disease and hypofibrinogenaemia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20589319 2010 A C-terminal amino acid substitution in the gamma-chain caused by a novel heterozygous frameshift mutation (Fibrinogen Matsumoto VII) results in hypofibrinogenaemia.
20508898 2010 Functional characterisation of plasma fibrin clots in Polish carriers of fibrinogen gammaArg275His mutation (fibrinogen Zabrze).
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20167083 2010 Fibrinogen beta variants confer protection against coronary artery disease in a Greek case-control study.
20128871 2010 Gene variants associated with venous thrombosis: confirmation in the MEGA study.
20059469 2010 Interaction between fibrinogen and IL-6 genetic variants and associations with cardiovascular disease risk in the Cardiovascular Health Study.
20031577 2009 Novel loci, including those related to Crohn disease, psoriasis, and inflammation, identified in a genome-wide association study of fibrinogen in 17 686 women: the Women's Genome Health Study.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19923982 2010 Inherited dysfibrinogenemia: clinical phenotypes associated with five different fibrinogen structure defects.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19687509 2009 The pleiotropic role of the fibrinogen gamma' chain in hemostasis.
19650644 2009 Impaired protofibril formation in fibrinogen gamma N308K is due to altered D:D and "A:a" interactions.
19515723 2009 Fibrinogen alpha and gamma genes and factor VLeiden in children with thromboembolism: results from 2 family-based association studies.
19492150 2009 Fibrinogen gamma gene 3'-end polymorphisms and risk of venous thromboembolism in the African-American and Caucasian population.
19412134 2009 Genetic variation in the fibrinogen-alpha and fibrinogen-gamma genes in relation to arterial stiffness: the Rotterdam Study.
19404553 2009 Fibrinogen Krakow: a novel hypo/dysfibrinogenemia mutation in fibrinogen gamma chain (Asn325Ile) affecting fibrin clot structure and function.
19332210 2009 Candidate genetic variants in the fibrinogen, methylenetetrahydrofolate reductase, and intercellular adhesion molecule-1 genes and plasma levels of fibrinogen, homocysteine, and intercellular adhesion molecule-1 among various race/ethnic groups: data from the Women's Genome Health Study.
19296670 2009 Crystal structure of human fibrinogen.
19193866 2009 Fibrinogen-induced endothelin-1 production from endothelial cells.
19190816 2009 Association study between variants in the fibrinogen gene cluster, fibrinogen levels and hypertension: results from the MONICA/KORA study.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
19122172 2009 Fibrinogen-gamma C-terminal fragments induce endothelial barrier dysfunction and microvascular leak via integrin-mediated and RhoA-dependent mechanism.
19059206 2009 Fibrinogen has chaperone-like activity.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19034331 2008 Serum fibrinogen levels are an independent predictor of mortality in patients with chronic kidney disease (CKD) stages 3 and 4.
18989528 2008 gammaA/gamma' fibrinogen inhibits thrombin-induced platelet aggregation.
18983496 2009 Thrombosis risk modification in transgenic mice containing the human fibrinogen thrombin-binding gamma' chain sequence.
18974842 2008 Gender differences in genetic risk profiles for cardiovascular disease.
18848323 2009 Prothrombotic genetic variants and atherosclerosis in patients with cerebral ischemia of arterial origin.
18842294 2008 Association between the SERPING1 gene and age-related macular degeneration: a two-stage case-control study.
18832913 2008 A novel Asp344Val substitution in the fibrinogen gamma chain (fibrinogen Caen) causes dysfibrinogenemia associated with thrombosis.
18780401 2008 Identification of N-linked glycoproteins in human milk by hydrophilic interaction liquid chromatography and mass spectrometry.
18779330 2008 Fibrinogen-elongated gamma chain inhibits thrombin-induced platelet response, hindering the interaction with different receptors.
18772067 2008 Common genetic polymorphisms and haplotypes of fibrinogen alpha, beta, and gamma chains affect fibrinogen levels and the response to proinflammatory stimulation in myocardial infarction survivors: the AIRGENE study.
18690352 2008 Variation in fibrinogen FGG and FGA genes and risk of stroke: the Rotterdam Study.
18676163 Congenital hypofibrinogenemia: characterization of two missense mutations affecting fibrinogen assembly and secretion.
18567199 2008 [Fibrinogen genes polymorphism in patients with ischemic stroke].
18331453 2008 Fibrinogen gene variation and ischemic stroke.
18278190 2008 Associations between common fibrinogen gene polymorphisms and cardiovascular disease in older adults. The Cardiovascular Health Study.
18239174 2008 Fibrinogen gamma' in ischemic stroke: a case-control study.
18208536 2008 Common genetic variants associated with plasma fibrin D-dimer concentration in older European- and African-American adults.
18202324 2008 Fibrinogen genes and myocardial infarction: a haplotype analysis.
18000621 2007 Fibrinogen Tolaga Bay: a novel gammaAla341Val mutation causing hypofibrinogenaemia.
17956865 2007 The functional role of an interleukin 6-inducible CDK9.STAT3 complex in human gamma-fibrinogen gene expression.
17951283 2008 Haplotypes of the fibrinogen gene and cerebral small vessel disease: the Rotterdam scan study.
17949478 2008 Fibrinogen synthesized by cancer cells augments the proliferative effect of fibroblast growth factor-2 (FGF-2).
17938819 2007 Fibrinogen Leipzig II (gamma351Gly-->Ser and gamma82Ala-->Gly): hypodysfibrinogenaemia due to two independent amino acid substitutions within the same polypeptide chain.
17883696 2007 Fibrinogen angers with a new deletion (gamma GVYYQ 346-350) causes hypofibrinogenemia with hepatic storage.
17854317 2007 Pseudo-exon activation caused by a deep-intronic mutation in the fibrinogen gamma-chain gene as a novel mechanism for congenital afibrinogenaemia.
17849064 2007 Clinical and biological features of 3 cases of hypofibrinogenemia associated with three different mutations (gamma Ala341Thr, Bbeta Tyr326Cys and Aalpha Asp496Asn).
17827388 2007 Genetic variation in 1253 immune and inflammation genes and risk of non-Hodgkin lymphoma.
17688324 2007 Probing the beta-chain hole of fibrinogen with synthetic peptides that differ at their amino termini.
17650452 2007 Fibrinogen Columbus: a novel gamma Gly200Val mutation causing hypofibrinogenemia in a family with associated thrombophilia.
17591786 2007 The chymotrypsin-like protease complex of Treponema denticola ATCC 35405 mediates fibrinogen adherence and degradation.
17565664 2007 Fibrinogen gamma-A chain precursor in CSF: a candidate biomarker for Alzheimer's disease.
17543500 2007 Activation of NF-kappaB by IL-1beta blocks IL-6-induced sustained STAT3 activation and STAT3-dependent gene expression of the human gamma-fibrinogen gene.
17445871 2007 The fibrinogen gamma (FGG) 10034C>T polymorphism is associated with venous thrombosis.
17403086 2007 Polymorphism 10034C>T is located in a region regulating polyadenylation of FGG transcripts and influences the fibrinogen gamma'/gammaA mRNA ratio.
17264959 2007 Fibrinogen gene haplotypes in relation to risk of coronary events and coronary and extracoronary atherosclerosis: the Rotterdam Study.
17263791 2007 Elevated plasma fibrinogen gamma' concentration is associated with myocardial infarction: effects of variation in fibrinogen genes and environmental factors.
17241179 2007 The association between fibrinogen haplotypes and myocardial infarction in men is partly mediated through pleiotropic effects on the serum IL-6 concentration.
17018627 2006 The COOH-terminal globular domain of fibrinogen gamma chain suppresses angiogenesis and tumor growth.
16940416 2007 Polymerization of fibrin: Direct observation and quantification of individual B:b knob-hole interactions.
16928957 2006 Matrix-specific suppression of integrin activation in shear stress signaling.
16846481 2006 The fibrinogen Aalpha R16C mutation results in fibrinolytic resistance.
16706972 2006 Association between patterns of nucleotide variation across the three fibrinogen genes and plasma fibrinogen levels: the Coronary Artery Risk Development in Young Adults (CARDIA) study.
16705085 2006 Analysis of fibrinogen variants at gamma387Ile shows that the side chain of gamma387 and the tertiary structure of the gammaC-terminal tail are important not only for assembly and secretion of fibrinogen but also for lateral aggregation of protofibrils and XIIIa-catalyzed gamma-gamma dimer formation.
16614319 2006 Common genetic variation in five thrombosis genes and relations to plasma hemostatic protein level and cardiovascular disease risk.
16581250 2006 p130Cas: a versatile scaffold in signaling networks.
16525568 2006 Epistatic and pleiotropic effects of polymorphisms in the fibrinogen and coagulation factor XIII genes on plasma fibrinogen concentration, fibrin gel structure and risk of myocardial infarction.
16524883 2006 Cell type-specific differential induction of the human gamma-fibrinogen promoter by interleukin-6.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16420584 2006 Haplotypes of the fibrinogen gamma gene do not affect the risk of myocardial infarction.
16363805 2005 A cluster of basic amino acid residues in the gamma370-381 sequence of fibrinogen comprises a binding site for platelet integrin alpha(IIb)beta3 (glycoprotein IIb/IIIa).
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16263699 2006 Elucidation of N-glycosylation sites on human platelet proteins: a glycoproteomic approach.
16144795 2005 Genetic variation in the fibrinogen gamma gene increases the risk for deep venous thrombosis by reducing plasma fibrinogen gamma' levels.
16141000 2005 Hypofibrinogenaemia caused by a novel FGG missense mutation (W253C) in the gamma chain globular domain impairing fibrinogen secretion.
16113784 2005 In vitro expression demonstrates impaired secretion of the gammaAsn319, Asp320 deletion variant fibrinogen.
16051597 2005 Fibrin but not adsorbed fibrinogen supports fibronectin assembly by spread platelets. Effects of the interaction of alphaIIb beta3 with the C terminus of the fibrinogen gamma-chain.
16005629 2005 Integrins and Src: dynamic duo of adhesion signaling.
15795540 2005 gammaAla82Gly represents a common fibrinogen gamma-chain variant in Caucasians.
15773976 2005 Human fibrinogen bound to Streptococcus pyogenes M protein inhibits complement deposition via the classical pathway.
15739255 2005 Fibrinogen and fragment D-induced vascular constriction.
15735812 2005 Contribution of haplotypes across the fibrinogen gene cluster to variation in risk of myocardial infarction.
15671034 2005 Regulation of gamma-fibrinogen chain expression by heterogeneous nuclear ribonucleoprotein A1.
15641787 2005 Interaction of fibrin(ogen) with leukocyte receptor alpha M beta 2 (Mac-1): further characterization and identification of a novel binding region within the central domain of the fibrinogen gamma-module.
15632207 2005 Fibrinogen Philadelphia, a hypodysfibrinogenemia characterized by abnormal polymerization and fibrinogen hypercatabolism due to gamma S378P mutation.
15583736 2004 Hypofibrinogenaemia associated with a novel heterozygous gamma289 Ala -->Val substitution (fibrinogen Dorfen).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15311153 2004 Investigation of residues in the fibrin(ogen) gamma chain involved in tissue plasminogen activator binding and plasminogen activation.
15304042 2004 Comparison of thrombin-catalyzed fibrin polymerization and factor XIIIa-catalyzed cross-linking of fibrin among three recombinant variant fibrinogens, gamma 275C, gamma 275H, and gamma 275A.
15284111 2004 Expression and analysis of a split premature termination codon in FGG responsible for congenital afibrinogenemia: escape from RNA surveillance mechanisms in transfected cells.
15217804 2004 Genetic and environmental determinants of fibrin structure and function: relevance to clinical disease.
14764520 2004 Substitution of the gamma-chain Asn308 disturbs the D:D interface affecting fibrin polymerization, fibrinopeptide B release, and FXIIIa-catalyzed cross-linking.
14760718 2004 Screening for N-glycosylated proteins by liquid chromatography mass spectrometry.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14691567 2004 Fibrinogen C-terminal peptidic sequences (Haptides) modulate fibrin polymerization.
12900415 2003 Functional analysis of interleukin 6 response elements (IL-6REs) on the human gamma-fibrinogen promoter: binding of hepatic Stat3 correlates negatively with transactivation potential of type II IL-6REs.
12871494 2003 Fibrinogen gamma chain functions.
12706644 2003 Fibrinogen Magdeburg I: a novel variant of human fibrinogen with an amino acid exchange in the fibrinopeptide A (Aalpha 9, Leu-->Pro).
12663453 2003 Fibrinogen gamma-chain splice variant gamma' alters fibrin formation and structure.
12624729 2003 Identification of a novel human angiopoietin-like gene expressed mainly in heart.
12617173 2002 New insights into fibrin (ogen) structure and function.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12356313 2002 2.8 A crystal structures of recombinant fibrinogen fragment D with and without two peptide ligands: GHRP binding to the "b" site disrupts its nearby calcium-binding site.
11986220 2002 Analysis of fibrinogen gamma-chain truncations shows the C-terminus, particularly gammaIle387, is essential for assembly and secretion of this multichain protein.
11986213 2002 Fibrinogen Hillsborough: a novel gammaGly309Asp dysfibrinogen with impaired clotting.
11748101 2001 Genetic variation in coagulation and fibrinolytic proteins and their relation with acute myocardial infarction: a systematic review.
11744726 2002 Incorporation of vitronectin into fibrin clots. Evidence for a binding interaction between vitronectin and gamma A/gamma' fibrinogen.
11562340 2001 Identification of four novel polymorphisms in the Aalpha and gamma fibrinogen genes and analysis of association with plasma levels of the protein.
11435303 2001 Fibrinogen Milano XII: a dysfunctional variant containing 2 amino acid substitutions, Aalpha R16C and gamma G165R.
11307817 2001 The amino acid sequence in fibrin responsible for high affinity thrombin binding.
11073102 2000 AlphaMbeta2 (CD11b/CD18, Mac-1) integrin activation by a unique monoclonal antibody to alphaM I domain that is divalent cation-sensitive.
11001902 2000 Afibrinogenemia: first identification of a splicing mutation in the fibrinogen gamma chain gene leading to a major gamma chain truncation.
10903502 2000 Fibrinogen interactions with ICAM-1 (CD54) regulate endothelial cell survival.
10747940 2000 Identification of amino acid sequences in fibrinogen gamma -chain and tenascin C C-terminal domains critical for binding to integrin alpha vbeta 3.
10605720 1999 Signaling through platelet integrin alpha IIb beta 3: inside-out, outside-in, and sideways.
10467729 1999 Fibrinogen.
10391209 1999 Characterization of single-nucleotide polymorphisms in coding regions of human genes.
10074346 1999 Conformational changes in fragments D and double-D from human fibrin(ogen) upon binding the peptide ligand Gly-His-Arg-Pro-amide.
9712878 1998 Identification of a novel recognition sequence for integrin alphaM beta2 within the gamma-chain of fibrinogen.
9628725 1998 Crystal structure of fragment double-D from human fibrin with two different bound ligands.
9333233 1997 Crystal structures of fragment D from human fibrinogen and its crosslinked counterpart from fibrin.
9207064 1997 The primary fibrin polymerization pocket: three-dimensional structure of a 30-kDa C-terminal gamma chain fragment complexed with the peptide Gly-Pro-Arg-Pro.
9028318 1997 Induction of fibrinogen biosynthesis and secretion from cultured pulmonary epithelial cells.
9016719 1997 Crystal structure of a 30 kDa C-terminal fragment from the gamma chain of human fibrinogen.
8910396 1996 The role of betagamma and alphagamma complexes in the assembly of human fibrinogen.
8756701 1996 Plasma factor XIII binds specifically to fibrinogen molecules containing gamma chains.
8566791 1995 Cloning and characterization of a lung-specific cDNA corresponding to the gamma chain of hepatic fibrinogen.
8509453 1993 Evidence for the selective association of a subpopulation of GPIIb-IIIa with the actin cytoskeletons of thrombin-activated platelets.
8470043 1993 Paris I dysfibrinogenemia: a point mutation in intron 8 results in insertion of a 15 amino acid sequence in the fibrinogen gamma-chain.
8404605 1993 Extrahepatic expression of fibrinogen by granulosa cells: potential role in ovulation.
8400260 1993 Fibrinogen Bern I: substitution gamma 337 Asn-->Lys is responsible for defective fibrin monomer polymerization.
8384496 1993 Binding of urinary protein C inhibitor to fibrin(ogen) and its binding mechanism.
8100742 1993 Fibrinogen mediates leukocyte adhesion to vascular endothelium through an ICAM-1-dependent pathway.
8080993 1994 A new substitution, gamma 358 Ser-->Cys, in fibrinogen Milano VII causes defective fibrin polymerization.
7878009 1995 Regulation of leukocyte-endothelium interaction and leukocyte transendothelial migration by intercellular adhesion molecule 1-fibrinogen recognition.
7841300 1994 Fibrinogen Milano V: a congenital dysfibrinogenaemia with a gamma 275 Arg-->Cys substitution.
7822297 1995 Structural recognition of a novel fibrinogen gamma chain sequence (117-133) by intercellular adhesion molecule-1 mediates leukocyte-endothelium interaction.
7654933 1995 Abnormal polymerization and normal binding of plasminogen and t-PA in three new dysfibrinogenaemias: Barcelona III and IV (gamma Arg 275-->His) and Villajoyosa (gamma Arg 275-->Cys).
7499336 1995 Characterization of the 5'-flanking region of the gene for the gamma chain of human fibrinogen.
7356959 1980 Studies on synthetic peptides that bind to fibrinogen and prevent fibrin polymerization. Structural requirements, number of binding sites, and species differences.
7306501 1981 Carboxy-terminal amino acid sequence of a human fibrinogen gamma-chain variant (gamma').
6957371 1982 Fibrinogen gamma chain locus is on chromosome 4 in man.
6933547 1980 Human plasma fibrinogen heterogeneity: evidence for an extended carboxyl-terminal sequence in a normal gamma chain variant (gamma').
6860649 1983 Dimeric half-molecules of human fibrinogen are joined through disulfide bonds in an antiparallel orientation.
6777381 1980 Ca2+-mediated association of glycoprotein G (thrombinsensitive protein, thrombospondin) with human platelets.
6689067 1983 Isolation and characterisation of cDNA clones for the A alpha- and gamma-chains of human fibrinogen.
6688357 1983 Characterization of a complementary deoxyribonucleic acid coding for the gamma chain of human fibrinogen.
6592597 1984 Localization of a fibrin gamma-chain polymerization site within segment Thr-374 to Glu-396 of human fibrinogen.
6575689 1983 Covalent structure of fibrinogen.
6575389 1983 Partial mRNA sequences for human A alpha, B beta, and gamma fibrinogen chains: evolutionary and functional implications.
6451630 1981 Localization of a fibrin polymerization site.
6383194 1984 Fibrinogen and fibrin.
6326808 1984 Platelet receptor recognition site on human fibrinogen. Synthesis and structure-function relationship of peptides corresponding to the carboxy-terminal segment of the gamma chain.
6325435 1984 Evidence that three adhesive proteins interact with a common recognition site on activated platelets.
6281794 1982 gamma and alpha chains of human fibrinogen possess sites reactive with human platelet receptors.
6092346 1984 Structure of the human gamma-fibrinogen gene. Alternate mRNA splicing near the 3' end of the gene produces gamma A and gamma B forms of gamma-fibrinogen.
6091742 1984 gamma and gamma' chains of human fibrinogen are produced by alternative mRNA processing.
5084810 1972 Quantitative studies on the release of platelet fibrinogen by thrombin.
3708159 1986 Characterization of fibrinogen Milano I: amino acid exchange gamma 330 Asp----Val impairs fibrin polymerization.
3563970 1986 Three abnormal fibrinogen variants with the same amino acid substitution (gamma 275 Arg----His): fibrinogens Bergamo II, Essen and Perugia.
3337908 1988 An apparently higher molecular weight gamma-chain variant in a new congenital abnormal fibrinogen Tochigi characterized by the replacement of gamma arginine-275 by cysteine.
3160702 1985 Localization of a fibrinogen calcium binding site between gamma-subunit positions 311 and 336 by terbium fluorescence.
2990550 1985 Nucleotide sequence of the gene for the gamma chain of human fibrinogen.
2976995 1988 Normal plasmic cleavage of the gamma-chain variant of "fibrinogen Saga" with an Arg-275 to His substitution.
2971046 1988 Characterization of an apparently lower molecular weight gamma-chain variant in fibrinogen Kyoto I. The replacement of gamma-asparagine 308 by lysine which causes accelerated cleavage of fragment D1 by plasmin and the generation of a new plasmin cleavage site.
2971042 1988 Substitution of gamma Arg-275 by Cys in an abnormal fibrinogen, "fibrinogen Osaka II". Evidence for a unique solitary cystine structure at the mutation site.
2819242 1989 Fibrinogen Kyoto III: a congenital dysfibrinogen with a gamma aspartic acid-330 to tyrosine substitution manifesting impaired fibrin monomer polymerization.
2742826 1989 High-resolution NMR studies of fibrinogen-like peptides in solution: interaction of thrombin with residues 1-23 of the A alpha chain of human fibrinogen.
2738036 1989 Fibrinogen Nagoya, a replacement of glutamine-329 by arginine in the gamma-chain that impairs the polymerization of fibrin monomer.
2665853 1989 Megakaryocyte and hepatocyte origins of human fibrinogen biosynthesis exhibit hepatocyte-specific expression of gamma chain-variant polypeptides.
2496144 1989 A gamma methionine-310 to threonine substitution and consequent N-glycosylation at gamma asparagine-308 identified in a congenital dysfibrinogenemia associated with posttraumatic bleeding, fibrinogen Asahi.
2328317 1990 Polymerization defect of fibrinogen Baltimore III due to a gamma Asn308----Ile mutation.
2257302 1990 Fibrinogen Baltimore I: polymerization defect associated with a gamma 292Gly----Val (GGC----GTC) mutation.
2143188 1990 A unique proteolytic fragment of human fibrinogen containing the A alpha COOH-terminal domain of the native molecule.
2133219 1990 Tissue-specific and ubiquitous expression of fibrinogen gamma-chain mRNA.
2071611 1991 A congenitally abnormal fibrinogen (Vlissingen) with a 6-base deletion in the gamma-chain gene, causing defective calcium binding and impaired fibrin polymerization.
1892842 1991 Recombinant human fibrinogen and sulfation of the gamma' chain.
1744509 1991 Endogenous platelet fibrinogen surface expression on activated platelets.
1733971 1992 Characterization of an abnormal fibrinogen Osaka V with the replacement of gamma-arginine 375 by glycine. The lack of high affinity calcium binding to D-domains and the lack of protective effect of calcium on fibrinolysis.
1685103 1991 Polymorphism of the human gamma chain fibrinogen gene.
1455400 1992 Heterozygous abnormal fibrinogen Osaka III with the replacement of gamma arginine-275 by histidine has an apparently higher molecular weight gamma-chain variant.
1429662 1992 Assembly and secretion of fibrinogen. Degradation of individual chains.
1421174 1992 Gene analyses of abnormal fibrinogens with a mutation in the gamma chain.
936108 1976 Disulfide bridges in nh2 -terminal part of human fibrinogen.