Property Summary

NCBI Gene PubMed Count 188
PubMed Score 276.43
PubTator Score 266.12

Knowledge Summary

Patent (139,693)

Expression

  Differential Expression (7)

Disease log2 FC p
lung cancer -1.200 2.5e-02
ductal carcinoma in situ 1.700 4.3e-02
esophageal adenocarcinoma 1.100 3.6e-02
intraductal papillary-mucinous neoplasm ... 1.500 1.1e-02
lung adenocarcinoma -1.068 5.0e-05
malignant mesothelioma 2.200 1.6e-06
non-small cell lung cancer -2.231 2.6e-28

 CSPA Cell Line (3)

Gene RIF (149)

AA Sequence

MRLLLALLGVLLSVPGPPVLSLEASEEVELEPCLAPSLEQQEQELTVALGQPVRLCCGRAERGGHWYKEG      1 - 70
SRLAPAGRVRGWRGRLEIASFLPEDAGRYLCLARGSMIVLQNLTLITGDSLTSSNDDEDPKSHRDPSNRH     71 - 140
SYPQQAPYWTHPQRMEKKLHAVPAGNTVKFRCPAAGNPTPTIRWLKDGQAFHGENRIGGIRLRHQHWSLV    141 - 210
MESVVPSDRGTYTCLVENAVGSIRYNYLLDVLERSPHRPILQAGLPANTTAVVGSDVELLCKVYSDAQPH    211 - 280
IQWLKHIVINGSSFGADGFPYVQVLKTADINSSEVEVLYLRNVSAEDAGEYTCLAGNSIGLSYQSAWLTV    281 - 350
LPEEDPTWTAAAPEARYTDIILYASGSLALAVLLLLAGLYRGQALHGRHPRPPATVQKLSRFPLARQFSL    351 - 420
ESGSSGKSSSSLVRGVRLSSSGPALLAGLVSLDLPLDPLWEFPRDRLVLGKPLGEGCFGQVVRAEAFGMD    421 - 490
PARPDQASTVAVKMLKDNASDKDLADLVSEMEVMKLIGRHKNIINLLGVCTQEGPLYVIVECAAKGNLRE    491 - 560
FLRARRPPGPDLSPDGPRSSEGPLSFPVLVSCAYQVARGMQYLESRKCIHRDLAARNVLVTEDNVMKIAD    561 - 630
FGLARGVHHIDYYKKTSNGRLPVKWMAPEALFDRVYTHQSDVWSFGILLWEIFTLGGSPYPGIPVEELFS    631 - 700
LLREGHRMDRPPHCPPELYGLMRECWHAAPSQRPTFKQLVEALDKVLLAVSEEYLDLRLTFGPYSPSGGD    701 - 770
ASSTCSSSDSVFSHDPLPLGSSSFPFGSGVQT                                          771 - 802
//

Text Mined References (199)

PMID Year Title