Property Summary

NCBI Gene PubMed Count 31
PubMed Score 6.93
PubTator Score 15.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
cutaneous lupus erythematosus 1.300 2.2e-03
osteosarcoma -1.932 8.3e-08
posterior fossa group B ependymoma 1.400 3.9e-08
glioblastoma 1.100 2.1e-05
group 3 medulloblastoma 1.400 8.9e-04
atypical teratoid / rhabdoid tumor 1.300 1.3e-05
primitive neuroectodermal tumor 1.200 1.2e-02
non-small cell lung cancer 1.146 2.0e-18
intraductal papillary-mucinous neoplasm ... 1.300 7.4e-03
lung cancer 1.200 7.4e-04
breast carcinoma 1.100 1.6e-04
pediatric high grade glioma 1.100 1.0e-03
subependymal giant cell astrocytoma 1.283 1.7e-02
lung adenocarcinoma 1.100 5.9e-08
Breast cancer 1.100 2.8e-08
ductal carcinoma in situ 1.100 5.9e-04
invasive ductal carcinoma 1.300 6.6e-03
ovarian cancer -1.400 3.0e-06

 GWAS Trait (1)

Gene RIF (10)

PMID Text
26905588 The rs151606 T>G was associated with an increased risk of lung cancer and rs12212247 T>C was associated with a decreased risk of lung cancer
23935994 This study was designed to determine the association of CCR6 and FGFR10P (tag)single nucleotide polymorphisms with Vogt-Koyanagi-Harada (VKH) syndrome, in two independent Chinese Han populations.
23554904 FOP is a centriolar satellite protein involved in ciliogenesis.
20526339 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19068216 Observational study of gene-disease association. (HuGE Navigator)
17888034 Since FGFR1OP is plays a significant role in lung cancer growth and progression, it may be useful as a prognostic biomarker and as a therapeutic target for lung cancer.
16690081 a 1.6A resolution crystal structure of the N-terminal dimerization domain of FOP. The structure comprises an alpha-helical bundle composed of two antiparallel chains, each of them having five alpha-helices.
16314388 CAP350 interacts directly with FOP (FGFR1 oncogene partner) to form a centrosomal complex required for microtubule anchoring.

AA Sequence

MAATAAAVVAEEDTELRDLLVQTLENSGVLNRIKAELRAAVFLALEEQEKVENKTPLVNESLKKFLNTKD      1 - 70
GRLVASLVAEFLQFFNLDFTLAVFQPETSTLQGLEGRENLARDLGIIEAEGTVGGPLLLEVIRRCQQKEK     71 - 140
GPTTGEGALDLSDVHSPPKSPEGKTSAQTTPSKIPRYKGQGKKKTSGQKAGDKKANDEANQSDTSVSLSE    141 - 210
PKSKSSLHLLSHETKIGSFLSNRTLDGKDKAGLCPDEDDMEGDSFFDDPIPKPEKTYGLRKEPRKQAGSL    211 - 280
ASLSDAPPLKSGLSSLAGAPSLKDSESKRGNTVLKDLKLISDKIGSLGLGTGEDDDYVDDFNSTSHRSEK    281 - 350
SEISIGEEIEEDLSVEIDDINTSDKLDDLTQDLTVSQLSDVADYLEDVA                         351 - 399
//

Text Mined References (40)

PMID Year Title
26905588 2016 Polymorphisms of the centrosomal gene (FGFR1OP) and lung cancer risk: a meta-analysis of 14,463 cases and 44,188 controls.
26638075 2015 A Dynamic Protein Interaction Landscape of the Human Centrosome-Cilium Interface.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23935994 2013 FGFR1OP tagSNP but not CCR6 polymorphisms are associated with Vogt-Koyanagi-Harada syndrome in Chinese Han.
23850713 2014 Genome-wide association study of Crohn's disease in Koreans revealed three new susceptibility loci and common attributes of genetic susceptibility across ethnic populations.
23554904 2013 FOP is a centriolar satellite protein involved in ciliogenesis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21841780 2011 A genome-wide association study identifies two new risk loci for Graves' disease.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21269460 2011 Initial characterization of the human central proteome.
20570966 2010 Fucosyltransferase 2 (FUT2) non-secretor status is associated with Crohn's disease.
20526339 2010 Genome-wide association study for vitiligo identifies susceptibility loci at 6q27 and the MHC.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19068216 2009 Investigation of Crohn's disease risk loci in ulcerative colitis further defines their molecular relationship.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18587394 2008 Genome-wide association defines more than 30 distinct susceptibility loci for Crohn's disease.
17888034 2007 Fibroblast growth factor receptor 1 oncogene partner as a novel prognostic biomarker and therapeutic target for lung cancer.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16690081 2006 Structure of the N-terminal domain of the FOP (FGFR1OP) protein and implications for its dimerization and centrosomal localization.
16462731 2006 The PITSLRE/CDK11p58 protein kinase promotes centrosome maturation and bipolar spindle formation.
16314388 2006 A complex of two centrosomal proteins, CAP350 and FOP, cooperates with EB1 in microtubule anchoring.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14654843 2003 Proteomic characterization of the human centrosome by protein correlation profiling.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12969958 2004 FOP-FGFR1 tyrosine kinase, the product of a t(6;8) translocation, induces a fatal myeloproliferative disease in mice.
12852856 2003 Polo-like kinase 1 regulates Nlp, a centrosome protein involved in microtubule nucleation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12221128 2002 Centrosomal proteins CG-NAP and kendrin provide microtubule nucleation sites by anchoring gamma-tubulin ring complex.
11689702 2001 8p12 stem cell myeloproliferative disorder: the FOP-fibroblast growth factor receptor 1 fusion protein of the t(6;8) translocation induces cell survival mediated by mitogen-activated protein kinase and phosphatidylinositol 3-kinase/Akt/mTOR pathways.
11076968 2000 The centrosomal protein C-Nap1 is required for cell cycle-regulated centrosome cohesion.
10373756 1999 [The 8p11 myeloproliferative syndrome].
9949182 1999 The t(6;8)(q27;p11) translocation in a stem cell myeloproliferative disorder fuses a novel gene, FOP, to fibroblast growth factor receptor 1.
7790358 1995 Cell cycle regulation of the activity and subcellular localization of Plk1, a human protein kinase implicated in mitotic spindle function.