Property Summary

NCBI Gene PubMed Count 25
PubMed Score 42.56
PubTator Score 35.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma -2.300 3.3e-06
esophageal adenocarcinoma -3.300 1.9e-02
uncontrolled asthma 1.200 4.1e-02
psoriasis 2.300 9.1e-119
non-small cell lung cancer 2.483 1.7e-09
intraductal papillary-mucinous neoplasm ... 3.000 1.1e-02
diabetes mellitus 1.400 1.2e-03
Breast cancer -2.400 1.5e-21

Gene RIF (14)

PMID Text
25704764 Up-regulated Sox12 induced by FoxQ1 promotes hepatocellular carcinoma invasion and metastasis by transactivating Twist1 and FGFBP1 expression.
25429350 HIV-1 Tat protein, but not HIV-1 Nef and gp120 proteins, competes with FGF-2 for binding to fibroblast growth factor binding protein 1 (FGF-BP1)
23592278 overexpression of FGFBP1 or loss of WISP-2 expression is closely related to the metastasis, invasion and poor prognosis of gallbladder cancer.
21436287 FGFBP1 associates with hypertension and that systematic analysis of signaling pathways can identify previously undescribed genetic associations.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20450993 Sequence variation in FGFBP1 may contribute to variation in bone mineral density, possibly influencing osteoporosis risk.
20450993 Observational study of gene-disease association. (HuGE Navigator)
19668233 KLF5 may promote breast cancer cell proliferation at least partially through directly activating the FGF-BP mRNA transcription.
19411256 KLF5 promotes breast cell survival partially through fibroblast growth factor-binding protein 1-pERK-mediated dual specificity MKP-1 protein phosphorylation and stabilization.
16352855 The upregulation of FGF-BP by regenerating renal tubular epithelial cells may provide a mechanism by which the regenerative and angiogenic activity of FGF-2 in renal capillaries can be modulated in children with HIV-HUS and other renal disease.
16324873 FGF-BP can be rate-limiting for tumor growth and serves as an angiogenic switch molecule, and that it represents an increasingly promising target molecule in anti-tumor therapy[review]
16257968 the FGF interaction domain is contained in the C terminus of FGF-BP1
15806171 Upregulation of FGF-BP expression after injury stimulates FGF activity at the wound site, thus enhancing the process of epithelial repair.

AA Sequence

MKICSLTLLSFLLLAAQVLLVEGKKKVKNGLHSKVVSEQKDTLGNTQIKQKSRPGNKGKFVTKDQANCRW      1 - 70
AATEQEEGISLKVECTQLDHEFSCVFAGNPTSCLKLKDERVYWKQVARNLRSQKDICRYSKTAVKTRVCR     71 - 140
KDFPESSLKLVSSTLFGNTKPRKEKTEMSPREHIKGKETTPSSLAVTQTMATKAPECVEDPDMANQRKTA    141 - 210
LEFCGETWSSLCTFFLSIVQDTSC                                                  211 - 234
//

Text Mined References (26)

PMID Year Title
25704764 2015 Sox12, a direct target of FoxQ1, promotes hepatocellular carcinoma metastasis through up-regulating Twist1 and FGFBP1.
23592278 2014 A comparative study of clinicopathological significance, FGFBP1, and WISP-2 expression between squamous cell/adenosquamous carcinomas and adenocarcinoma of the gallbladder.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21436287 2011 Pathway analysis shows association between FGFBP1 and hypertension.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20450993 2010 A common variant in fibroblast growth factor binding protein 1 (FGFBP1) is associated with bone mineral density and influences gene expression in vitro.
19668233 2009 Krüppel-like factor 5 promotes breast cell proliferation partially through upregulating the transcription of fibroblast growth factor binding protein 1.
19411256 2009 KLF5 promotes breast cell survival partially through fibroblast growth factor-binding protein 1-pERK-mediated dual specificity MKP-1 protein phosphorylation and stabilization.
17178288 2006 The angiogenic switch molecule, secreted FGF-binding protein, an indicator of early stages of pancreatic and colorectal adenocarcinoma.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16352855 2006 Role of fibroblast growth factor-binding protein in the pathogenesis of HIV-associated hemolytic uremic syndrome.
16324873 2006 The fibroblast growth factor-binding protein FGF-BP.
16257968 2006 Identification of the fibroblast growth factor (FGF)-interacting domain in a secreted FGF-binding protein by phage display.
15806171 2005 The fibroblast growth factor binding protein is a novel interaction partner of FGF-7, FGF-10 and FGF-22 and regulates FGF activity: implications for epithelial repair.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11509569 2001 Enhancement of fibroblast growth factor (FGF) activity by an FGF-binding protein.
11407864 2001 Bifunctional effects of heparin-binding protein HBp17 on DNA synthesis in cells.
11291074 2001 Fibroblast growth factor-binding protein expression changes with disease progression in clinical and experimental human squamous epithelium.
11148217 2001 Fibroblast growth factor-binding protein is a novel partner for perlecan protein core.
10753873 2000 Induction of the angiogenic modulator fibroblast growth factor-binding protein by epidermal growth factor is mediated through both MEK/ERK and p38 signal transduction pathways.
9784842 1998 Purification of heparin-binding protein HBp17 and identification of HBp17 heparin binding site.
9334727 1997 A secreted FGF-binding protein can serve as the angiogenic switch in human cancer.
1885605 1991 Characterization and molecular cloning of a putative binding protein for heparin-binding growth factors.