Property Summary

NCBI Gene PubMed Count 49
PubMed Score 109.83
PubTator Score 63.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
malignant mesothelioma 3232 6.9e-08
Hydrolethalus syndrome 128 3.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Essential Hypertension 94 0.0 3.0
Gout 104 0.0 1.9
Disease Target Count Z-score Confidence
Cancer 2499 0.0 4.0
Disease Target Count
Trichomegaly 1

Expression

  Differential Expression (2)

Disease log2 FC p
Hydrolethalus syndrome 1.617 3.2e-02
malignant mesothelioma -4.700 6.9e-08

 OMIM Phenotype (1)

 MGI Phenotype (1)

Gene RIF (19)

AA Sequence

MSLSFLLLLFFSHLILSAWAHGEKRLAPKGQPGPAATDRNPRGSSSRQSSSSAMSSSSASSSPAASLGSQ      1 - 70
GSGLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANMLSVLEIFAVSQGIVGIRGVFSNK     71 - 140
FLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKPQH    141 - 210
ISTHFLPRFKQSEQPELSFTVTVPEKKKPPSPIKPKIPLSAPRKNTNSVKYRLKFRFG                211 - 268
//

Text Mined References (51)

PMID Year Title