Property Summary

NCBI Gene PubMed Count 691
PubMed Score 10573.50
PubTator Score 4323.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (18)

Disease log2 FC p
autosomal dominant Emery-Dreifuss muscul... 1.059 1.4e-02
Breast cancer -2.300 7.1e-16
breast carcinoma -1.600 4.2e-04
cystic fibrosis 2.251 1.8e-07
Down syndrome 1.100 3.0e-02
ductal carcinoma in situ -1.500 1.9e-04
fibroadenoma -1.300 4.8e-02
group 3 medulloblastoma -1.300 1.3e-03
invasive ductal carcinoma -1.259 1.1e-02
lung adenocarcinoma -1.200 4.5e-16
lung cancer -1.500 3.2e-02
malignant mesothelioma -2.900 1.2e-07
medulloblastoma, large-cell -1.100 2.7e-03
nasopharyngeal carcinoma 1.100 7.7e-03
non-small cell lung cancer -1.310 4.5e-15
ovarian cancer -1.600 1.9e-07
psoriasis -2.500 2.0e-05
ulcerative colitis 1.900 1.6e-03
See source...

Protein-protein Interaction (2)

Gene RIF (624)

AA Sequence

MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAAGSPRTRGRRT      1 - 70
EERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSIT     71 - 140
TLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGV    141 - 210
CANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAIL    211 - 280
FLPMSAKS                                                                  281 - 288
//

Text Mined References (701)

PMID Year Title