Property Summary

Ligand Count 60
NCBI Gene PubMed Count 691
PubMed Score 10573.50
PubTator Score 4323.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (18)

Disease log2 FC p
autosomal dominant Emery-Dreifuss muscul... 1.059 1.4e-02
Breast cancer -2.300 7.1e-16
breast carcinoma -1.600 4.2e-04
cystic fibrosis 2.251 1.8e-07
Down syndrome 1.100 3.0e-02
ductal carcinoma in situ -1.500 1.9e-04
fibroadenoma -1.300 4.8e-02
group 3 medulloblastoma -1.300 1.3e-03
invasive ductal carcinoma -1.259 1.1e-02
lung adenocarcinoma -1.200 4.5e-16
lung cancer -1.500 3.2e-02
malignant mesothelioma -2.900 1.2e-07
medulloblastoma, large-cell -1.100 2.7e-03
nasopharyngeal carcinoma 1.100 7.7e-03
non-small cell lung cancer -1.310 4.5e-15
ovarian cancer -1.600 1.9e-07
psoriasis -2.500 2.0e-05
ulcerative colitis 1.900 1.6e-03
See source...

Protein-protein Interaction (2)

PDB (20)

Gene RIF (624)

AA Sequence

MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAAGSPRTRGRRT      1 - 70
EERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSIT     71 - 140
TLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGV    141 - 210
CANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAIL    211 - 280
FLPMSAKS                                                                  281 - 288
//

Text Mined References (701)

PMID Year Title