Property Summary

NCBI Gene PubMed Count 79
PubMed Score 290.49
PubTator Score 162.78

Knowledge Summary

Patent

No data available

Gene RIF (62)

PMID Text
26723851 we suggest that considerable mechanistic differences exist between humans and mice with regard to the nuclear receptors controlling the VitA-FGF15/19 axis.
26567701 discusses current knowledge of the complex biology of the endocrine FGFs.
26343925 FGF-19 increment after OGL was positively associated with age, and negatively associated with abnormal glucose regulation and statin treatment
26323668 Study shows that FGF19 can be secreted and promotes ovarian cancer progression such as proliferation and invasion by activating FGFR4.
26293907 FGF19 correlates with severity of liver disease and can potentially serve as an indicator of chronic cholestatic liver injury.
26256900 Suggest a potential connection between gallbladder cholangiocyte-derived FGF19 and bile acid metabolism that could lead to metabolic dysregulation following cholecystectomy.
26152288 KL methylation is a characteristic of many breast cancer cases . However, the resulting or associated perturbation in FGFR4 expression, similar to FGF19, could be utilized as a biomarker for poor prognosis
26028580 In mice with humanized livers, expression of an FGF19 transgene corrects bile acid signaling defects, resulting in normalization of bile acid synthesis, the bile acid pool, and liver size.
25854696 Fibroblast growth factor 19 might be associated with biochemical recurrence after radical prostatectomy by promoting cell proliferation and epithelial-mesenchymal transition of prostate cancer
25664662 The data suggest that FGF19/FGF21 circulating levels and hepatic gene expression of the associated signaling pathway are significantly dysregulated in type 2 diabetes.
25595885 The pathogenesis of intestinal failure associated liver disease is uncertain, we therefore investigated the role of FGF19 and pro-inflammatory cytokines has on this disease state.
25547779 In this review, we have reported the altered expression of FGF19 in non-alcoholic fatty liver disease and hepatocellular carcinoma; we find limited information on the role of FGF19 in other liver diseases
25080475 Describe a nontumorigenic FGF19 variant, M70, which regulates bile acid metabolism and, through inhibition of bile acid synthesis/reduction of excess hepatic bile acid accumulation, protects mice from cholestatic liver injury.
24841294 FGF19 levels were reduced in non-diabetic obese subjects as compared to lean controls and obese type 2 diabetic subjects.
24827712 [review] While FGF19 is a negative feedback regulator of bile acid metabolism and can circulate as a hormone, emerging evidence has showed its autocrine or exocrine function.
24813368 obesity appears as the predominant determinant of the abnormalities in FGF21 and FGF19 levels. Opposite changes in beta-Klotho expression in fat and liver indicate potential tissue-specific alterations in the responsiveness to endocrine FGFs in obesity
24798001 In hepatocellular carcinoma, FGF19 amplifications, known to activate Wnt signaling, were mutually exclusive with CTNNB1 and AXIN1 mutations, and significantly associated with cirrhosis.
24728076 FGF19 stimulates tumor progression by activating the STAT3 pathway.
24321096 These results suggest that SREBP-2 negatively regulates the FXR-mediated transcriptional activation of the FGF19 gene in human intestinal cells.
24260557 Reduced serum FGF19 levels could be involved in the pathophysiology of gestational diabetes mellitus, while increased serum FGF21 levels could be a compensatory response to this disease.
24248542 Quantification of FGF19 expression appears to provide valuable prognostic information in breast cancer
23981126 Reduced fibroblast growth factor 19 is a feature of bile acid diarrhea.
23940810 Serum FGF19 is associated with the presence and severity of coronary artery disease in a Chinese population.
23803094 FGF19 expression is not associated with lymph node metastasis and locally invasive characteristics of the tumor in colorectal cancers
23628619 Fasting serum FGF19 levels were decreased in Chinese subjects with IFG and inversely associated with fasting glucose levels.
23456506 FGF19 protein expression might be an effective predictor of early recurrence and a marker for poor prognosis of hepatocellular carcinoma.
23329754 A decrease in fasting FGF19 levels is associated with the development of non-alcoholic fatty liver disease in obese adolescents.
23205607 FGF19 (fibroblast growth factor 19) as a novel target gene for activating transcription factor 4 in response to endoplasmic reticulum stress
23064887 The specificity of hFGF19 signaling is greatly altered in a mouse model system.
23038264 HNF4alpha and LRH-1 promote active transcription histone marks on the Cyp7a1 promoter that are reversed by FGF19 in a SHP-dependent manner
22561792 These results suggest that FGF19 is transcriptionally activated through multiple Farnesoid X receptor-responsive elements in the promoter region
22442730 Differential specificity of endocrine FGF19 and FGF21 to FGFR1 and FGFR4 in complex with KLB.
22396169 Mouse Fgf15 and human FGF19 play key roles in enterohepatic signaling, regulation of liver bile acid biosynthesis, gallbladder motility and metabolic homeostasis
22267484 The FGF19 effect on APOA was attenuated by transfection of primary hepatocytes with siRNA against the FGF19 receptor 4 (FGFR4).
22166511 FGF-19 levels are low in type 2 diabetic patients with metabolic syndrome.
21953282 found to activate signaling pathways in cell lines of cholangiocytic, enteroendocrine, and enterocytic origin
21747170 Pregnane X receptor activation induces FGF19-dependent tumor aggressiveness in humans and mice
21691104 The serum bile salts were slightly but significantly elevated, and the levels of the endocrine-acting fibroblast growth factor 19 (FGF19) and FGF21 were increased.
21653700 Sulfated glycosaminoglycans are required for specific and sensitive fibroblast growth factor (FGF) 19 signaling via FGF receptor 4 and betaKlotho.
21574752 Baseline serum FGF-19 levels are significantly lower in obese patients with type 2 diabetes and is at least partially dependent upon nutritional status, but is not related to glucose metabolism or insulin sensitivity parameters.
21437243 FGFR4 activation mediates the induction of hepatocyte proliferation and the suppression of bile acid biosynthesis by FGF19.
21436455 findings show that FGF19 activates a physiologically important, insulin-independent endocrine pathway that regulates hepatic protein and glycogen metabolism
21397858 Data established that FGF19 is an important driver gene in HCC.
20691689 A new mechanism for bile acid diarrhea: defective feedback inhibition of bile acid biosynthesis between fasting serum 7alphaC4 and FGF19 levels.
20093562 Patients with nonalcoholic fatty liver disease (NAFLD) show an unimpaired intestinal FGF19 production. However, the hepatic response to FGF19 is impaired in NAFLD patients with insulin resistance (HOMA score > or =2.5).
20018895 activation of FGFR4 is the mechanism whereby FGF19 can increase hepatocyte proliferation and induce hepatocellular carcinoma formation.
20013647 FGF19 is associated with a beneficial metabolic profile in both control and chronic hemodialysis patients.
19681655 Plasma FGF19 did not significantly differ between controls, and subjects with obesity or Cushing's syndrome.
19237543 FGF15/FGFR4 integrates growth factor signaling with hepatic bile acid metabolism and insulin action
19233843 the inhibitory effect of FGF-19 on insulin activation of hepatic fatty acid synthesis constitutes a mechanism that would explain the beneficial effect of FGF-19 on metabolic syndrome.
19185005 The liver expresses FGF19 under conditions of extrahepatic cholestasis.
18829467 Both FGF23 and FGF21 require intact alpha or betaKlotho for signaling, respectively, whereas FGF19 can signal through a Klotho chimera consisting of the N terminus of alphaKlotho and the C terminus of betaKlotho.
18559909 Circulating levels of FGF21 but not FGF19 are strongly related to body weight and serum levels of leptin, adiponectin, and insulin in both anorectic and normal-weight women.
17711860 a functional FGF19 receptor may consist of FGF receptor (FGFR) and heparan sulfate complexed with either alphaKlotho or betaKlotho
17599042 FGF19 is coexpressed with its cognate receptor FGFR4 in primary human liver, lung, and colon tumors and in a subset of human colon cancer cell lines, where their interactions are important for tumor growth.
17339340 Klotho/betaKlotho have evolved as a compensatory mechanism for the poor ability of heparin/heparan sulfate to promote binding of FGF19, -21, and -23 to their cognate receptors
17000708 This study reveals an important role for FOXC1 in the direct regulation of the FGF19-FGFR4-MAPK pathway to promote both the development and maintenance of anterior segment structures within the eye.
14976145 FGF19 is able to increase metabolic rate concurrently with an increase in fatty acid oxidation.
14730967 The crystal structure of FGF19 is reported and a model proposed for the interaction of FGF19 with its sole receptor, fibroblast growth factor receptor 4.
12815072 demonstrated that FGF-19, acting as an FXR-induced signaling molecule, represses expression of the CYP7A1 gene; this signaling cascade defines a novel mechanism for feedback repression of bile acid biosynthesis
12057932 The formation of liver tumors in transgenic mice overexpressing human fibroblast growth factor 19 (FGF19) in skeletal muscle
11956156 FGF19 transgenic mice had a significant and specific reduction in fat mass that resulted from an increase in energy expenditure. FGF19 transgenic mice did not become obese or diabetic on a high fat diet.

AA Sequence

MRSGCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDC      1 - 70
ARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHR     71 - 140
LPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVR    141 - 210
SPSFEK                                                                    211 - 216
//

Text Mined References (81)

PMID Year Title
26723851 2016 Farnesoid X receptor-dependent and -independent pathways mediate the transcriptional control of human fibroblast growth factor 19 by vitamin A.
26567701 2016 Therapeutic potential of the endocrine fibroblast growth factors FGF19, FGF21 and FGF23.
26343925 2015 Factors associated with fibroblast growth factor 19 increment after oral glucose loading in patients who were previously admitted for coronary angiography.
26323668 2015 Fibroblast growth factor 19 is correlated with an unfavorable prognosis and promotes progression by activating fibroblast growth factor receptor 4 in advanced-stage serous ovarian cancer.
26293907 2015 Expression of hepatic Fibroblast Growth Factor 19 is enhanced in Primary Biliary Cirrhosis and correlates with severity of the disease.
26256900 Effect of cholecystectomy on bile acid synthesis and circulating levels of fibroblast growth factor 19.
26152288 2015 Frequent methylation of the KLOTHO gene and overexpression of the FGFR4 receptor in invasive ductal carcinoma of the breast.
26028580 2015 Fibroblast Growth Factor Signaling Controls Liver Size in Mice With Humanized Livers.
25854696 2015 FGF19 promotes progression of prostate cancer.
25664662 2015 Perturbations of fibroblast growth factors 19 and 21 in type 2 diabetes.
25595885 2015 Loss of ileum decreases serum fibroblast growth factor 19 in relation to liver inflammation and fibrosis in pediatric onset intestinal failure.
25547779 2015 Targeting fibroblast growth factor 19 in liver disease: a potential biomarker and therapeutic target.
25080475 2014 A nontumorigenic variant of FGF19 treats cholestatic liver diseases.
24841294 2014 Calorie restriction and Roux-en-Y gastric bypass have opposing effects on circulating FGF21 in morbidly obese subjects.
24827712 2014 Role of fibroblast growth factor 19 in maintaining nutrient homeostasis and disease.
24813368 2015 Opposite alterations in FGF21 and FGF19 levels and disturbed expression of the receptor machinery for endocrine FGFs in obese patients.
24798001 2014 Genomic portrait of resectable hepatocellular carcinomas: implications of RB1 and FGF19 aberrations for patient stratification.
24728076 2014 Separating Tumorigenicity from Bile Acid Regulatory Activity for Endocrine Hormone FGF19.
24321096 2014 SREBP-2 negatively regulates FXR-dependent transcription of FGF19 in human intestinal cells.
24260557 2013 Serum concentrations of fibroblast growth factors 19 and 21 in women with gestational diabetes mellitus: association with insulin resistance, adiponectin, and polycystic ovary syndrome history.
24248542 2014 High fibroblast growth factor 19 (FGF19) expression predicts worse prognosis in invasive ductal carcinoma of breast.
23981126 2013 Fibroblast growth factor 19 in patients with bile acid diarrhoea: a prospective comparison of FGF19 serum assay and SeHCAT retention.
23940810 2013 Serum levels of fibroblast growth factor 19 are inversely associated with coronary artery disease in chinese individuals.
23803094 2013 Lack of relationships between FGF19 staining pattern, lymph node metastasis and locally invasive characteristics of the tumor in colorectal cancers.
23747249 2013 Diet1 functions in the FGF15/19 enterohepatic signaling axis to modulate bile acid and lipid levels.
23628619 2013 Serum fibroblast growth factor 19 levels are decreased in Chinese subjects with impaired fasting glucose and inversely associated with fasting plasma glucose levels.
23456506 2013 Expression of fibroblast growth factor 19 is associated with recurrence and poor prognosis of hepatocellular carcinoma.
23329754 2012 A decrease in fasting FGF19 levels is associated with the development of non-alcoholic fatty liver disease in obese adolescents.
23205607 2013 FGF19 (fibroblast growth factor 19) as a novel target gene for activating transcription factor 4 in response to endoplasmic reticulum stress.
23064887 2013 Sulfated glycosaminoglycan-assisted receptor specificity of human fibroblast growth factor (FGF) 19 signaling in a mouse system is different from that in a human system.
23038264 2012 Nuclear receptors HNF4? and LRH-1 cooperate in regulating Cyp7a1 in vivo.
22561792 2012 Involvement of multiple elements in FXR-mediated transcriptional activation of FGF19.
22442730 2012 Differential specificity of endocrine FGF19 and FGF21 to FGFR1 and FGFR4 in complex with KLB.
22396169 2012 Physiology of FGF15/19.
22267484 2012 FGF19 signaling cascade suppresses APOA gene expression.
22166511 2011 Fibroblast growth factor-19 levels in type 2 diabetic patients with metabolic syndrome.
21953282 2012 The human gallbladder secretes fibroblast growth factor 19 into bile: towards defining the role of fibroblast growth factor 19 in the enterobiliary tract.
21747170 2011 Pregnane X receptor activation induces FGF19-dependent tumor aggressiveness in humans and mice.
21691104 2011 Alterations of hormonally active fibroblast growth factors after Roux-en-Y gastric bypass surgery.
21653700 2011 Sulfated glycosaminoglycans are required for specific and sensitive fibroblast growth factor (FGF) 19 signaling via FGF receptor 4 and betaKlotho.
21574752 2011 Serum concentrations of fibroblast growth factor 19 in patients with obesity and type 2 diabetes mellitus: the influence of acute hyperinsulinemia, very-low calorie diet and PPAR-? agonist treatment.
21437243 2011 FGF19 regulates cell proliferation, glucose and bile acid metabolism via FGFR4-dependent and independent pathways.
21436455 2011 FGF19 as a postprandial, insulin-independent activator of hepatic protein and glycogen synthesis.
21397858 2011 Identification of a therapeutic strategy targeting amplified FGF19 in liver cancer by Oncogenomic screening.
20691689 2010 Chenodeoxycholate in females with irritable bowel syndrome-constipation: a pharmacodynamic and pharmacogenetic analysis.
20453838 2010 Genome-wide association study identifies five new breast cancer susceptibility loci.
20094046 2010 Fibroblast growth factor signalling: from development to cancer.
20093562 2010 The hepatic response to FGF19 is impaired in patients with nonalcoholic fatty liver disease and insulin resistance.
20018895 2010 FGF19-induced hepatocyte proliferation is mediated through FGFR4 activation.
20013647 2010 Fibroblast growth factor 19 serum levels: relation to renal function and metabolic parameters.
19681655 2010 Plasma concentrations of fibroblast growth factors 21 and 19 in patients with Cushing's syndrome.
19237543 2009 FGF15/FGFR4 integrates growth factor signaling with hepatic bile acid metabolism and insulin action.
19233843 2009 Fibroblast growth factor-19, a novel factor that inhibits hepatic fatty acid synthesis.
19185005 2009 High expression of the bile salt-homeostatic hormone fibroblast growth factor 19 in the liver of patients with extrahepatic cholestasis.
19085950 2009 Bile acids activate fibroblast growth factor 19 signaling in human hepatocytes to inhibit cholesterol 7alpha-hydroxylase gene expression.
18829467 2008 C-terminal tail of FGF19 determines its specificity toward Klotho co-receptors.
18559909 2008 Plasma concentrations of fibroblast growth factors 19 and 21 in patients with anorexia nervosa.
18187602 2008 betaKlotho is required for fibroblast growth factor (FGF) 21 signaling through FGF receptor (FGFR) 1c and FGFR3c.
17711860 2007 Co-receptor requirements for fibroblast growth factor-19 signaling.
17627937 2007 Liver-specific activities of FGF19 require Klotho beta.
17623664 2007 Tissue-specific expression of betaKlotho and fibroblast growth factor (FGF) receptor isoforms determines metabolic activity of FGF19 and FGF21.
17599042 2008 Targeting FGF19 inhibits tumor growth in colon cancer xenograft and FGF19 transgenic hepatocellular carcinoma models.
17339340 2007 Molecular insights into the klotho-dependent, endocrine mode of action of fibroblast growth factor 19 subfamily members.
17000708 2006 FGF19 is a target for FOXC1 regulation in ciliary body-derived cells.
16597617 2006 Receptor specificity of the fibroblast growth factor family. The complete mammalian FGF family.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15199049 2004 Functional phylogeny relates LET-756 to fibroblast growth factor 9.
14976145 2004 Fibroblast growth factor 19 increases metabolic rate and reverses dietary and leptin-deficient diabetes.
14730967 2004 The crystal structure of fibroblast growth factor (FGF) 19 reveals novel features of the FGF family and offers a structural basis for its unusual receptor affinity.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12815072 2003 Definition of a novel growth factor-dependent signal cascade for the suppression of bile acid biosynthesis.
12792807 2003 Evolutionary conservation of CCND1-ORAOV1-FGF19-FGF4 locus from zebrafish to human.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11956156 2002 Transgenic mice expressing human fibroblast growth factor-19 display increased metabolic rate and decreased adiposity.
11294897 2001 Identification of tyrosine residues in constitutively activated fibroblast growth factor receptor 3 involved in mitogenesis, Stat activation, and phosphatidylinositol 3-kinase activation.
11110663 2000 Identification of synergistic signals initiating inner ear development.
10652257 2000 Tyrosine 766 in the fibroblast growth factor receptor-1 is required for FGF-stimulation of phospholipase C, phospholipase D, phospholipase A(2), phosphoinositide 3-kinase and cytoskeletal reorganisation in porcine aortic endothelial cells.
10579907 1999 Phospholipase C-gamma as a signal-transducing element.
10525310 1999 FGF-19, a novel fibroblast growth factor with unique specificity for FGFR4.
9931477 1999 Structure and expression of a novel human FGF, FGF-19, expressed in the fetal brain.