Property Summary

NCBI Gene PubMed Count 25
PubMed Score 38.27
PubTator Score 10.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
psoriasis 6694 4.2e-25
Disease Target Count Z-score Confidence
Klinefelter's syndrome 56 0.0 4.0
Disease Target Count Z-score Confidence
Opitz-GBBB syndrome 18 3.34 1.7
Duane Retraction Syndrome 13 3.044 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -2.000 4.2e-25

Gene RIF (4)

AA Sequence

MGAARLLPNLTLCLQLLILCCQTQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTG      1 - 70
RRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTA     71 - 140
FQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTR    141 - 210
RPQPLT                                                                    211 - 216
//

Text Mined References (25)

PMID Year Title