Property Summary

NCBI Gene PubMed Count 13
PubMed Score 9.36
PubTator Score 4.96

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

AA Sequence

MAALASSLIRQKREVREPGGSRPVSAQRRVCPRGTKSLCQKQLLILLSKVRLCGGRPARPDRGPEPQLKG      1 - 70
IVTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFNLIPVGLRVVTIQSAKLGHYMAMNAEGLLYSSPHFT     71 - 140
AECRFKECVFENYYVLYASALYRQRRSGRAWYLGLDKEGQVMKGNRVKKTKAAAHFLPKLLEVAMYQEPS    141 - 210
LHSVPEASPSSPPAP                                                           211 - 225
//

Text Mined References (13)

PMID Year Title