Property Summary

NCBI Gene PubMed Count 188
PubMed Score 1583.18
PubTator Score 745.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma -4.200 6.2e-09
osteosarcoma 1.078 7.7e-03
ependymoma -1.600 6.1e-05
group 3 medulloblastoma -3.800 4.2e-06
cystic fibrosis -2.225 4.8e-06
atypical teratoid/rhabdoid tumor -3.200 9.0e-10
medulloblastoma, large-cell -3.000 9.8e-06
primitive neuroectodermal tumor -1.700 7.8e-03
lung carcinoma 1.100 3.5e-15
breast carcinoma -1.400 1.5e-34
Breast cancer -2.500 1.0e-33
ductal carcinoma in situ -1.100 4.1e-03
invasive ductal carcinoma -1.600 2.3e-02
ovarian cancer -3.800 4.9e-21
pituitary cancer -1.700 6.8e-04
Down syndrome 1.300 8.0e-03

Synonym

Accession P05230 B2R5T0 D3DQF2 P07502 Q16588 FGF-1
Symbols AFGF
ECGF
FGFA
ECGFA
ECGFB
FGF-1
HBGF1
HBGF-1
GLIO703
ECGF-beta
FGF-alpha

Gene

PANTHER Protein Class (2)

PDB

1EVT   3OJV   1QCT   2K4A   2KI6   1RY7   1DJS   1E0O   3CU1   3OJ2   3OJM   4J23   2KI4   1AXM   1DZC   1DZD   1HKN   1JQZ   1JT3   1JT4   1JT5   1JT7   1JTC   1JY0   1K5U   1K5V   1M16   1NZK   1P63   1PZZ   1Q03   1Q04   1RG8   1RML   1YTO   1Z2V   1Z4S   2AFG   2AQZ   2AXM   2ERM   2HW9   2HWA   2HWM   2HZ9   2K43   2K8R   2NTD   2Q9X   2RQ9   3B9U   3BA4   3BA5   3BA7   3BAD   3BAG   3BAH   3BAO   3BAQ   3BAU   3BAV   3BB2   3CQA   3CRG   3CRH   3CRI   3FGM   3FJ8   3FJ9   3FJA   3FJB   3FJC   3FJD   3FJE   3FJF   3FJH   3FJI   3FJJ   3FJK   3HOM   3JUT   3K1X   3O3Q   3UD7   3UD8   3UD9   3UDA   4Q91   4Q9G   4Q9P   4QAL   4QBC   4QBV   4QC4   4QO3   4XKI   4YOL  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GWAS Trait (1)

Gene RIF (123)

PMID Text
26840910 The role of intracellular FGF1 is to protect the cell against stress conditions by providing an additional signal for cell survival, independently of receptor-activated signaling cascades.
26836284 Data suggest folding of FGF1 is critical for its nonclassical secretion via permeability of lipid bilayer; mutation of proline135 in C-terminus of FGF1 leads to partial unfolding/decrease in FGF1's ability to permeabilize phosphatidylserine bilayers.
26420862 expression of human FGF1 solely in beta-cells in fgf1(-/-) animals prevented overnutrition induced compensatory beta-cell differentiation.
26400350 FGF-1 synthesis and secretion by synovial fibroblasts were significantly increased in osteoarthritis.
26391572 These findings suggest that the presence of FGF1 may serve as a prognostic indicator and a potential therapeutic target for non-small cell lung cancer patients, especially for lung squamous cell carcinoma.
26365194 The analysis identified a signaling axis between FGF signaling and the transcription factor Sox1, which is preferentially expressed in stem- and mesenchymal-like breast cancers.
26362179 FGF1-FGFR1 axis promotes tongue squamous cell carcinoma metastasis through the epithelial-mesenchymal transition pathway
26138239 FGF1 expression is increased in lung from idiopathic pulmonary fibrosis patients.
26109071 p120RasGAP shields Akt from deactivating phosphatases in FGF1 signaling, but loses this ability once cleaved by caspase-3.
25589163 Study presents a transcript profiling of remyelinated multiple sclerosis lesions and identified FGF1 as a promoter of remyelination
25560297 Results show that stress functionally associates FGF1 with AHNAK2 and both proteins with the cytoskeleton and their co-localization in the vicinity of the cell membrane. AHNAK2 seems to be an important element of the FGF1 export pathway.
25236340 This review is focused on the role of HDGF in tumorigenesis and metastasis, and provides insight for application in clinical cancer therapy as well as its clinical implications as a prognostic marker in cancer progression.
25104610 These results suggested that human FGF1B promoter was active in ependymal cells, neurons, and a portion of dopaminergic neurons
25043058 discovery of unexpected, neomorphic insulin-sensitizing action for exogenous non-mitogenic human FGF1 with therapeutic potential for the treatment of insulin resistance and type 2 diabetes
25015527 the sulfate in position 6 of d-glucosamine was essential for the mitogenic activity but not for the interaction with FGF-1
24711160 While results are awaited from these clinical investigations in squamous NSCLC and other disease settings, additional research is needed to elucidate the role of FGF/FGFR signaling in the biology of NSCLC of different histologies
24613087 FGF1 gene polymorphism is associated with a lower risk of developing cleft palate or cleft lip in Iranian patients. clet palatot cleft lip
24595027 Nucleolin-FGF1 interaction is critical for the intranuclear phosphorylation of FGF1 by PKCdelta and thereby the regulation of nuclear export of FGF1.
24510686 HIV-1 gp120-induced neurotoxic effects are inhibited by the presence of fibroblast growth factor 1 (FGF1)
24464990 the genotype distribution of rs34011 within fibroblast growth factor 1 was significantly different between Alzheimer's disease and control group
24304385 By introducing two stabilizing mutations in the C-terminal part of the protein, obtained are variants highly resistant proteolytically with prolonged half-life and enhanced mitogenic activity.
23990967 Data suggest that the enhanced cell growth was likely due to the electrical stimulation up-regulated secretion of FGF-1 and FGF-2.
23949615 precursor of the hormone Irisin (FNCD5) were abundantly expressed in all three fat depots, along with fibroblast growth factors (FGF) FGF1, FGF7 and FGF10, whereas, FGF19 and FGF21 were undetectable.
23912956 Both FGF1 and ERBB2 significantly influenced overall survival in breast cancer patients, especially among women with low levels of Native American ancestry.
23557133 We demonstrate that mesenchymal stromal cells increase FGF-1 secretion on co-culture with Human primary chondrocytes, which, in turn, is responsible for increased Human primary chondrocytes proliferation in pellet co-cultures.
23469107 R50E suppresses angiogenesis induced by FGF1 or FGF2, and thereby indirectly suppresses tumorigenesis, in addition to its possible direct effect on tumor cell proliferation in vivo
23457216 studied the functional consequences of HSulf-2 activity on fibroblast growth factor (FGF)-induced mitogenesis and found that the enzyme could differentially regulate FGF1 and FGF2 activities
23426545 The expression of FGF-1 in the in vitro fertilization (IVF) implantation failure group is less than in the fertile group, which suggests that growth factors such as FGF-1 are important maternal factors effecting implantation
23143756 FGF1 polymorphism is associated with breast cancer.
23133616 forms of FGF-1 that enhance thermostability or eliminate buried reactive thiols demonstrate a shorter distribution half-life, a longer elimination half-life, and a longer mean residence time (MRT) in comparison to wild-type FGF-1
23047594 The folding transition state of FGF-1 is shown to be highly polarized, with the majority of turns adopting either native-like or denatured-like structure in the folding transition state.
22321063 LRRC59 facilitates transport of cytosolic FGF1 through nuclear pores by interaction with Kpns and movement of LRRC59 along the ER and NE membranes
22057274 Plasticity in interactions of fibroblast growth factor 1 (FGF1) N terminus with FGF receptors underlies promiscuity of FGF1.
21990352 Acidic fibroblast growth factor (FGF) potentiates glial-mediated neurotoxicity by activating FGFR2 IIIb protein.
21963769 In the present study, a novel hybrid protein combining LL-37 with haFGF was designed.
21894939 FGFR3c, critical for bone development, elicit a similar response to Fgf1 and Fgf2 at low, but not at high, concentrations; results demonstrate the versatility of FGFR3c response to fgf1 and fgf2 and highlight the complexity in fgf signaling.
21806346 [review] In this review, the authors discuss recent and ongoing research into the role of fibroblast growth factor and transforming growth factor-beta in the etiopathogenesis of craniosynostosis.
21555518 FGF1 is a target gene of the BACH1 transcription factor according to ChIP-seq analysis in HEK 293 cells.
21462296 FGF1 is implicated in the occurrence of cleft palate.
21448824 The world-wide largest angiogenesis gene therapy trial in 525 patients suffering from critical limb ischemia and treated with the non-viral gene construct for fibroblast growth factor (NV1FGF) or placebo was negative for all endpoints.
21356388 Fibroblast growth factor 1/fibroblast growth factor receptor 3 (FGF1/FGFR-3) signaling are mediators leading to the increased migration and invasion.
21239704 A unique role for hematopoietic stem cell cytokines in vascular tube morphogenesis and sprouting and a novel upstream priming role for VEGF and FGF to facilitate the action of promorphogenic hematopoietic cytokines.
21190667 Hydrogen/deuterium exchange rates were measured on the urea-denatured hFGF-1 to obtain the information with regard to the persistent residual interaction(s) in the unfolded hFGF-1.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20889570 Data suggest that an FGFR1alpha-to-FGFR1beta isoform switch and increased FGF1-induced activation of FGFR1beta may result in a proliferative advantage that plays a key role during bladder tumor progression.
20863990 S100A13 promotes the release of FGF-1 protein, but does not affect the transportation of FGF-1 protein in human umbilical vein endothelial cells
20706664 This article describes a new, rapid procedure based on Taq polymerase for the precise assembly of DNA oligonucleotides to yield the complete human fibroblast growth factor 1 (FGF1) gene.
20673868 Observational study of gene-disease association. (HuGE Navigator)
20672350 Observational study of gene-disease association. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20504870 The FGF1 -1385A/G polymorphism is shown to not influence the risk of developing adenomyosis but is associated with the risk of developing endometriosis.
20504870 Observational study of gene-disease association. (HuGE Navigator)
20452482 Observational study of gene-disease association. (HuGE Navigator)
20424473 Observational study of gene-disease association. (HuGE Navigator)
20298684 Our data suggested no association between the FGF1 -1385 C>T polymorphism and AD risk in Chinese Han population.
20298684 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20189986 RFX1 may negatively regulate the self-renewal of GBM-SCs through modulating FGF-1B and FGF1 expression levels by binding the 18-bp cis-elements of the F1B promoter.
20072657 Data show that a significant increase in plasma SDF-1alpha, and an immediate decrease in plasma VEGF and FGF levels after chemotherapy.
20036812 Studies indicate communication between tumor cells and their microenvironment is through polypeptide growth factors EGF, FGF, PDGF and receptors for these growth factors.
20027339 The level of FGF-1 in osteosarcomas was significantly higher than in chondrosarcomas.
19923735 Results describe a series of mutations in fibroblast growth factor 1 at crystal contacts designed to both reduce side-chain entropy and replace the solvent-mediated interface with direct side-chain contacts to improve neutron diffraction.
19845895 Observational study of gene-disease association. (HuGE Navigator)
19835837 NMR characterization of copper and lipid interactions of the C2B domain of synaptotagmin I-relevance to the non-classical secretion of the human acidic fibroblast growth factor (hFGF-1).
19683004 These results show that position 83 in FGF-1 is thermodynamically optimized to accept a free cysteine.
19574212 that the main role of heparin in FGF-induced signaling is to protect this naturally unstable protein against heat and/or proteolytic degradation and heparin is not essential for a direct FGF1-FGFR interaction and receptor activation
19453261 Observational study of gene-disease association. (HuGE Navigator)
19249349 SH2B1beta enhances FGF1-induced neurite outgrowth in PC12 cells mainly through MEK-ERK1/2-STAT3-Egr1 pathway.
19112917 The hematopoietic properties of yolk sac may be dependent on signaling through FGF receptors and FGF1 plays an important role in hematopoietic stem cell homeostasis.
18819464 Myometrium conversion into leiomyoma and an increase in its mass is accompanied by a significant increase in aFGF gene expression.
18762812 klotho is a potential tumor suppressor and an inhibitor of the IGF-1 pathway and activator of the FGF pathway in human breast cancer
18669637 the FGF binding domain and the heparin binding domain are necessary for the hBP3 interaction with endogenous FGF and the activation of FGFR signaling in vivo
18505824 FGF antagonizes Wnt signaling by inhibiting Wnt-induced transcription and suggest that multiple mechanisms, including downregulation of TCFs and Wnt receptors, contribute to this effect.
18495870 FGF-1-induced cell permeabilization and derived consequences depend on the Cx composition of connexin hemichannels
18441324 integrin alphavbeta3 binding to FGF1 plays a role in FGF1 signaling
18308335 The Asx-Pro-Asx-Gly type I beta-turn motif stability in FGF1.
18298822 Observational study of gene-disease association. (HuGE Navigator)
18202770 the induction of apoptosis through the inhibition of endogenous FGF signaling is caspase-9 pathway- dependent
17963255 FGF and FGFR may have a role in cleft lip and cleft palate
17909102 Observational study of gene-disease association. (HuGE Navigator)
17909102 genetic variation within FGF1 cosegregates with elevated blood pressure in hypertensive families and that this association is likely to be mediated by upregulation of renal FGF1 expression.
17893707 Observational study of gene-disease association. (HuGE Navigator)
17852407 FGF and PDGF have roles in cell proliferation and migration in osteoblastic cells
17610236 FGF1 was scored as one of several lead candidate gene products to modulate the transdifferentiation process and is shown here to exert inhibitory effects on adipogenic commitment and differentiation.
17570396 Results describe the stabilization of human fibroblast growth factor-1 by targeting the N and C terminus beta-strand interactions.
17538174 Amplification of FGF-1 at 5q31 in ovarian cancer tissues leads to increased angiogenesis, and autocrine stimulation of cancer cells, which may result in poorer overall survival in patents with high-grade advanced stage serous ovarian cancer
17204151 Observational study of gene-disease association. (HuGE Navigator)
17134911 Can be efficiently expressed in Pichia pastoris.
16886895 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16807244 analysis of heparan sulfate-related oligosaccharide binding to fibroblast growth factors 1 and 2 and their receptors
16766579 FGF-1 can have an antifibrogenic role, inducing apoptosis of fibroblasts and inhibiting myofibroblast differentiation
16495214 Hsp90 is required for translocation of FGF-1 and FGF-2 across the endosomal membrane
16411766 Two molecules of suramin appear to bind simultaneously to one molecule of hFGF-1 with high affinity
16392031 Data suggest that minor changes of local kynurenic acid concentration may modulate fibroblast growth factor-1 release, cell proliferation, and ultimately tissue damage in different pathological conditions.
16355415 A type I 4:6 turn at turn 1 of FGF-1 appears essential for efficient mitogenic function.
16316338 FGF-1 might have both autocrine and paracrine functions in renal inflammation
16219767 FGF1 dimerization upon heparin was favored over monomeric interactions even when a large excess of saccharide was present
16091423 Data indicate that after endocytosis, fibroblast growth factor receptor (FGFR)4 and its bound ligand, FGF1, are sorted mainly to the recycling compartment, whereas FGFR1-3 with ligand are sorted mainly to degradation in the lysosomes.
15882952 A recombinant nonmitogenic form of aFGF (nhaFGF) was purified and the mitogenic activity of the purified nhaFGF was decreased dramatically comparable to that of the wild-type aFGF (haFGF).
15870071 FGF-1 regulates HO-1 expression through Nrf2
15835896 FGF-1 contains a second putative NLS (NLS2), which is located near the C-terminus. It is a bipartite NLS consisting of two clusters of lysines separated by a spacer of 10 amino acids.
15632285 residues flanking the the beta4/beta5 and beta8/beta9 beta-hairpin turns of human acidic fibroblast growth factor are a primary structural determinant of the conformation within the turn
15561939 FGF-1 is a key human adipogenic factor, involved in fat tissue growth.
15382229 1.10-A atomic resolution X-ray structure of human fibroblast growth factor 1 (FGF-1), a member of the beta-trefoil superfold, has been determined
15358178 Observational study of gene-disease association. (HuGE Navigator)
15358178 Promoter polymorphism and genetic susceptibility for Alzheimer's disease
15314170 Data show that mouse and human fibroblast growth factor 1 (FGF-1) internal ribosome entry sites show similar activity profiles, and have a conserved structural domain at both the nucleotide sequence and RNA structure levels.
14673954 FGF1 transcriptionally induces membrane type-1 matrix metalloproteinase expression in a prostate carcinoma cell line.
14627732 An alternative core packing group, involving a set of five positions, has been introduced into human acidic FGF-1
12871334 Binding studies demonstrated no high-affinity interaction of FGF-1 with fibrinogen or fibrin; unlike FGF-2, FGF-1 can support vascular endothelial cell growth only if continually present in soluble form.
12788899 According to phase of menstrual cycle, endometrial stromal cells from endometriosis patients in late proliferative phase had higher bFGF mRNA values and lower 1B FGF-antisense mRNA compared with controls
12750963 Observational study of gene-disease association. (HuGE Navigator)
12750963 No associations of intracranial aneurysm and FGF1 were found.
12484774 The conformational stability and dynamics of FGF1 have been measured on the basis of amide proton-exchange kinetics, monitored by two-dimensional NMR spectroscopy.
12440521 The mitogenic acitivity of AFGF was inhibited by the synthetic peptide Ac-ValTyrMetSerProPhe-NH2.
12417591 Maintenance of the human umbilical vein endothelial cell phenotype and differentiation into smooth muscle-like cells are reciprocally controlled by fibroblast growth factor-1 and activin A.
12145206 Recombinant human FGF-1 binds to both the catalytic alpha-subunit and to the regulatory beta-subunit of CK2. A correlation between the mitogenic potential of FGF-1 mutants and their ability to bind to CK2 alpha was observed.
12118009 identification of rare partially unfolded states in equilibrium with the native conformation
12057924 bFGF and aFGF may suppress endothelial-dependent monocyte recruitment and thus have an anti-inflammatory action during angiogenesis in chronic inflammation but inhibit the immunoinflammatory tumor defense mechanism
12008951 possible role of fibroblast growth factors in expression of genes of the plasminogen activator system in breast fibroblasts
11847269 Alternative type I and I' turn conformations in the beta8/beta9 beta-hairpin
11245213 HIV-1 gp120-induced neurotoxic effects are inhibited by the presence of fibroblast growth factor 1 (FGF1)
9501919 HIV-1 gp120-induced neurotoxic effects are inhibited by the presence of fibroblast growth factor 1 (FGF1)
7542239 HIV-1 gp120-induced neurotoxic effects are inhibited by the presence of fibroblast growth factor 1 (FGF1)

AA Sequence

MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVY      1 - 70
IKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHY     71 - 140
GQKAILFLPLPVSSD                                                           141 - 155
//

Text Mined References (194)

PMID Year Title
26840910 2016 Identification of new FGF1 binding partners-Implications for its intracellular function.
26836284 2016 Folding of Fibroblast Growth Factor 1 Is Critical for Its Nonclassical Release.
26420862 2016 FGF1 Mediates Overnutrition-Induced Compensatory ?-Cell Differentiation.
26400350 2015 Upregulation of fibroblast growth factor 1 in the synovial membranes of patients with late stage osteoarthritis.
26391572 2015 Clinicopathological significance of fibroblast growth factor 1 in non-small cell lung cancer.
26365194 2015 Sox10 Regulates Stem/Progenitor and Mesenchymal Cell States in Mammary Epithelial Cells.
26362179 2015 FGF1-FGFR1 axis promotes tongue squamous cell carcinoma (TSCC) metastasis through epithelial-mesenchymal transition (EMT).
26138239 2015 Increased FGF1-FGFRc expression in idiopathic pulmonary fibrosis.
26109071 2015 RasGAP Shields Akt from Deactivating Phosphatases in Fibroblast Growth Factor Signaling but Loses This Ability Once Cleaved by Caspase-3.
25589163 2014 Transcript profiling of different types of multiple sclerosis lesions yields FGF1 as a promoter of remyelination.
25560297 2015 AHNAK2 Participates in the Stress-Induced Nonclassical FGF1 Secretion Pathway.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25236340 2014 HDGF: a novel jack-of-all-trades in cancer.
25104610 2015 Human FGF1 promoter is active in ependymal cells and dopaminergic neurons in the brains of F1B-GFP transgenic mice.
25043058 2014 Endocrinization of FGF1 produces a neomorphic and potent insulin sensitizer.
25015527 2014 Importance of the polarity of the glycosaminoglycan chain on the interaction with FGF-1.
24711160 2014 Fibroblast growth factor signaling and inhibition in non-small cell lung cancer and their role in squamous cell tumors.
24613087 2014 Investigation of FGF1 and FGFR gene polymorphisms in a group of Iranian patients with nonsyndromic cleft lip with or without cleft palate.
24595027 2014 Nucleolin regulates phosphorylation and nuclear export of fibroblast growth factor 1 (FGF1).
24464990 2014 A variant within FGF1 is associated with Alzheimer's disease in the Han Chinese population.
24304385 2014 Protease resistant variants of FGF1 with prolonged biological activity.
23990967 2013 Electrical stimulation promotes wound healing by enhancing dermal fibroblast activity and promoting myofibroblast transdifferentiation.
23949615 2014 Gene expression profiling in subcutaneous, visceral and epigastric adipose tissues of patients with extreme obesity.
23912956 2013 Associations with growth factor genes (FGF1, FGF2, PDGFB, FGFR2, NRG2, EGF, ERBB2) with breast cancer risk and survival: the Breast Cancer Health Disparities Study.
23597563 2013 Molecular mechanism of SSR128129E, an extracellularly acting, small-molecule, allosteric inhibitor of FGF receptor signaling.
23557133 2013 Fibroblast growth factor-1 is a mesenchymal stromal cell-secreted factor stimulating proliferation of osteoarthritic chondrocytes in co-culture.
23469107 2013 A dominant-negative FGF1 mutant (the R50E mutant) suppresses tumorigenesis and angiogenesis.
23457216 2013 HSulf sulfatases catalyze processive and oriented 6-O-desulfation of heparan sulfate that differentially regulates fibroblast growth factor activity.
23426545 2013 Fibroblast growth factor-1 expression in the endometrium of patients with repeated implantation failure after in vitro fertilization.
23143756 2013 Associations of polymorphisms in the genes of FGFR2, FGF1, and RBFOX2 with breast cancer risk by estrogen/progesterone receptor status.
23133616 2012 Pharmacokinetic properties of 2nd-generation fibroblast growth factor-1 mutants for therapeutic application.
23047594 2012 Experimental support for the foldability-function tradeoff hypothesis: segregation of the folding nucleus and functional regions in fibroblast growth factor-1.
22321063 2012 Nuclear import of exogenous FGF1 requires the ER-protein LRRC59 and the importins Kpn?1 and Kpn?1.
22057274 2012 Plasticity in interactions of fibroblast growth factor 1 (FGF1) N terminus with FGF receptors underlies promiscuity of FGF1.
21990352 2011 Acidic fibroblast growth factor (FGF) potentiates glial-mediated neurotoxicity by activating FGFR2 IIIb protein.
21963769 2012 Expression of a novel dual-functional protein--the antimicrobial peptide LL-37 fused with human acidic fibroblast growth factor in Escherichia coli.
21894939 2011 The physical basis of FGFR3 response to fgf1 and fgf2.
21806346 2011 Molecular signaling in pathogenesis of craniosynostosis: the role of fibroblast growth factor and transforming growth factor-?.
21555518 2011 The BTB and CNC homology 1 (BACH1) target genes are involved in the oxidative stress response and in control of the cell cycle.
21462296 2011 Variation in FGF1, FOXE1, and TIMP2 genes is associated with nonsyndromic cleft lip with or without cleft palate.
21448824 2011 [Therapeutic angiogenesis using gene transfer and stem cell therapy in peripheral artery disease].
21356388 2011 Colorectal cancer cells activate adjacent fibroblasts resulting in FGF1/FGFR3 signaling and increased invasion.
21348951 2011 Hypertrophy-associated polymorphisms ascertained in a founder cohort applied to heart failure risk and mortality.
21239704 2011 VEGF and FGF prime vascular tube morphogenesis and sprouting directed by hematopoietic stem cell cytokines.
21190667 2011 Investigating the refolding pathway of human acidic fibroblast growth factor (hFGF-1) from the residual structure(s) obtained by denatured-state hydrogen/deuterium exchange.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20889570 2010 Altered splicing of FGFR1 is associated with high tumor grade and stage and leads to increased sensitivity to FGF1 in bladder cancer.
20863990 2010 Effect of human S100A13 gene silencing on FGF-1 transportation in human endothelial cells.
20706664 2010 Novel method of cell-free in vitro synthesis of the human fibroblast growth factor 1 gene.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20672350 2010 Genetic variants in COL2A1, COL11A2, and IRF6 contribute risk to nonsyndromic cleft palate.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20504870 2010 Association between genetic polymorphisms in fibroblast growth factor (FGF)1 and FGF2 and risk of endometriosis and adenomyosis in Chinese women.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
20422052 2010 A novel fibroblast growth factor-1 (FGF1) mutant that acts as an FGF antagonist.
20298684 2010 No association of the C>T polymorphism that is located 1385 upstream from initial code of fibroblast growth factor 1 gene with Alzheimer's disease in Chinese.
20220137 2010 The heterohexameric complex structure, a component in the non-classical pathway for fibroblast growth factor 1 (FGF1) secretion.
20189986 2010 Regulation of FGF1 gene promoter through transcription factor RFX1.
20145243 2010 Gentisic acid, a compound associated with plant defense and a metabolite of aspirin, heads a new class of in vivo fibroblast growth factor inhibitors.
20094046 2010 Fibroblast growth factor signalling: from development to cancer.
20072657 2010 Late release of circulating endothelial cells and endothelial progenitor cells after chemotherapy predicts response and survival in cancer patients.
20036812 2010 Growth factors in tumor microenvironment.
20027339 2009 Endostatin, placental growth factor, and fibroblast growth factors-1 and -2 in the sera of patients with primary osteosarcomas.
19923735 2009 Engineering an improved crystal contact across a solvent-mediated interface of human fibroblast growth factor 1.
19845895 2009 Fine mapping of the CELIAC2 locus on chromosome 5q31-q33 in the Finnish and Hungarian populations.
19835837 2010 NMR characterization of copper and lipid interactions of the C2B domain of synaptotagmin I-relevance to the non-classical secretion of the human acidic fibroblast growth factor (hFGF-1).
19683004 2009 Structural basis of conserved cysteine in the fibroblast growth factor family: evidence for a vestigial half-cystine.
19574212 2009 Increased protein stability of FGF1 can compensate for its reduced affinity for heparin.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19249349 2009 SH2B1beta enhances fibroblast growth factor 1 (FGF1)-induced neurite outgrowth through MEK-ERK1/2-STAT3-Egr1 pathway.
19247306 2009 The FGF family: biology, pathophysiology and therapy.
19229075 2009 FGF-1 induces expression of LXRalpha and production of 25-hydroxycholesterol to upregulate the apoE gene in rat astrocytes.
19112917 2008 [The expression of basic fibroblast growth factor 1 during human embryonic yolk sac hematopoiesis].
18819464 2008 [Fibroblast growth factor gene expression in uterine leiomyomas].
18762812 2008 Klotho: a tumor suppressor and a modulator of the IGF-1 and FGF pathways in human breast cancer.
18669637 2008 Effect of FGF-binding protein 3 on vascular permeability.
18505824 2008 Fibroblast growth factor signaling uses multiple mechanisms to inhibit Wnt-induced transcription in osteoblasts.
18495870 2008 Connexin hemichannel composition determines the FGF-1-induced membrane permeability and free [Ca2+]i responses.
18441324 2008 Direct binding of integrin alphavbeta3 to FGF1 plays a role in FGF1 signaling.
18400376 2008 The release of fibroblast growth factor-1 from melanoma cells requires copper ions and is mediated by phosphatidylinositol 3-kinase/Akt intracellular signaling pathway.
18308335 2008 A logical OR redundancy within the Asx-Pro-Asx-Gly type I beta-turn motif.
18298822 2008 Association study in the 5q31-32 linkage region for schizophrenia using pooled DNA genotyping.
18202770 2008 Caspase-9 pathway activation by inhibiting endogenous fibroblast growth factor signaling in human glioma cells.
18187602 2008 betaKlotho is required for fibroblast growth factor (FGF) 21 signaling through FGF receptor (FGFR) 1c and FGFR3c.
17963255 2007 Sequence evaluation of FGF and FGFR gene conserved non-coding elements in non-syndromic cleft lip and palate cases.
17909102 2007 Fibroblast growth factor 1 gene and hypertension: from the quantitative trait locus to positional analysis.
17893707 2008 An association screen of myelin-related genes implicates the chromosome 22q11 PIK4CA gene in schizophrenia.
17852407 2007 Differential effect of FGF and PDGF on cell proliferation and migration in osteoblastic cells.
17610236 2008 Microarray analyses of transdifferentiated mesenchymal stem cells.
17570396 2007 Spackling the crack: stabilizing human fibroblast growth factor-1 by targeting the N and C terminus beta-strand interactions.
17567994 2007 Prominent use of distal 5' transcription start sites and discovery of a large number of additional exons in ENCODE regions.
17538174 2007 Whole genome oligonucleotide-based array comparative genomic hybridization analysis identified fibroblast growth factor 1 as a prognostic marker for advanced-stage serous ovarian adenocarcinomas.
17204151 2007 VEGF, FGF1, FGF2 and EGF gene polymorphisms and psoriatic arthritis.
17134911 2007 Improved yields of full-length functional human FGF1 can be achieved using the methylotrophic yeast Pichia pastoris.
17133345 2007 Differential signal transduction of alternatively spliced FGFR2 variants expressed in human mammary epithelial cells.
16886895 2006 Genetic predisposition of responsiveness to therapy for chronic hepatitis C.
16807244 2006 Heparan sulfate-related oligosaccharides in ternary complex formation with fibroblast growth factors 1 and 2 and their receptors.
16766579 2006 Acidic fibroblast growth factor decreases alpha-smooth muscle actin expression and induces apoptosis in human normal lung fibroblasts.
16756958 2006 Fibroblast growth factor 16 and 18 are expressed in human cardiovascular tissues and induce on endothelial cells migration but not proliferation.
16597617 2006 Receptor specificity of the fibroblast growth factor family. The complete mammalian FGF family.
16495214 2006 FGF-1 and FGF-2 require the cytosolic chaperone Hsp90 for translocation into the cytosol and the cell nucleus.
16411766 2006 Understanding the mechanism of the antimitogenic activity of suramin.
16392031 2005 Kynurenic acid inhibits the release of the neurotrophic fibroblast growth factor (FGF)-1 and enhances proliferation of glia cells, in vitro.
16355415 2006 Conversion of type I 4:6 to 3:5 beta-turn types in human acidic fibroblast growth factor: effects upon structure, stability, folding, and mitogenic function.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16316338 2005 Immunolocalization of fibroblast growth factor-1 (FGF-1), its receptor (FGFR-1), and fibroblast-specific protein-1 (FSP-1) in inflammatory renal disease.
16219767 2005 Cooperative dimerization of fibroblast growth factor 1 (FGF1) upon a single heparin saccharide may drive the formation of 2:2:1 FGF1.FGFR2c.heparin ternary complexes.
16091423 2005 Different intracellular trafficking of FGF1 endocytosed by the four homologous FGF receptors.
15882952 2005 High-level expression and purification of a nonmitogenic form of human acidic fibroblast growth factor in Escherichia coli.
15870071 2005 Fibroblast growth factor-1 induces heme oxygenase-1 via nuclear factor erythroid 2-related factor 2 (Nrf2) in spinal cord astrocytes: consequences for motor neuron survival.
15863030 2005 Cellular signaling by fibroblast growth factor receptors.
15835896 2005 Two nuclear localization signals required for transport from the cytosol to the nucleus of externally added FGF-1 translocated into cells.
15695515 2005 Interactions of multiple heparin binding growth factors with neuropilin-1 and potentiation of the activity of fibroblast growth factor-2.
15632285 2005 Sequence swapping does not result in conformation swapping for the beta4/beta5 and beta8/beta9 beta-hairpin turns in human acidic fibroblast growth factor.
15561939 2004 Fibroblast growth factor 1: a key regulator of human adipogenesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15382229 2004 An atomic resolution structure for human fibroblast growth factor 1.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15358178 2004 Promoter polymorphism in fibroblast growth factor 1 gene increases risk of definite Alzheimer's disease.
15314170 2004 Internal ribosome entry site structural motifs conserved among mammalian fibroblast growth factor 1 alternatively spliced mRNAs.
15199049 2004 Functional phylogeny relates LET-756 to fibroblast growth factor 9.
14732692 2004 Insights into the molecular basis for fibroblast growth factor receptor autoinhibition and ligand-binding promiscuity.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14673954 2004 Fibroblast growth factor-1 transcriptionally induces membrane type-1 matrix metalloproteinase expression in prostate carcinoma cell line.
14627732 2003 Accommodation of a highly symmetric core within a symmetric protein superfold.
12871334 2003 FGF-2 but not FGF-1 binds fibrin and supports prolonged endothelial cell growth.
12815063 2003 Fibroblast growth factor (FGF) homologous factors share structural but not functional homology with FGFs.
12788899 2003 Different basic fibroblast growth factor and fibroblast growth factor-antisense expression in eutopic endometrial stromal cells derived from women with and without endometriosis.
12750963 2003 Association of positional and functional candidate genes FGF1, FBN2, and LOX on 5q31 with intracranial aneurysm.
12746488 2003 S100A13 mediates the copper-dependent stress-induced release of IL-1alpha from both human U937 and murine NIH 3T3 cells.
12484774 2002 Investigation of the structural stability of the human acidic fibroblast growth factor by hydrogen-deuterium exchange.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12440521 2002 Selection of peptide ligands binding to fibroblast growth factor receptor 1.
12417591 2003 Human umbilical vein endothelium-derived cells retain potential to differentiate into smooth muscle-like cells.
12145206 2002 Binding of FGF-1 variants to protein kinase CK2 correlates with mitogenicity.
12118009 2002 Identification of rare partially unfolded states in equilibrium with the native conformation in an all beta-barrel protein.
12057924 2002 Down-modulation of monocyte transendothelial migration and endothelial adhesion molecule expression by fibroblast growth factor: reversal by the anti-angiogenic agent SU6668.
12008951 2002 Differential effects of fibroblast growth factors on expression of genes of the plasminogen activator and insulin-like growth factor systems by human breast fibroblasts.
11964394 2002 Identification of ribosome-binding protein p34 as an intracellular protein that binds acidic fibroblast growth factor.
11847269 2002 Alternative type I and I' turn conformations in the beta8/beta9 beta-hairpin of human acidic fibroblast growth factor.
11731227 2001 Multiple fibroblast growth factors support growth of the ureteric bud but have different effects on branching morphogenesis.
11509569 2001 Enhancement of fibroblast growth factor (FGF) activity by an FGF-binding protein.
11432880 2001 Copper induces the assembly of a multiprotein aggregate implicated in the release of fibroblast growth factor 1 in response to stress.
11294897 2001 Identification of tyrosine residues in constitutively activated fibroblast growth factor receptor 3 involved in mitogenesis, Stat activation, and phosphatidylinositol 3-kinase activation.
11069186 2000 Crystal structure of fibroblast growth factor receptor ectodomain bound to ligand and heparin.
11032250 2000 Selection of peptide ligands that bind to acid fibroblast growth factor.
10903182 2000 Signaling and transcriptional regulation in early mammalian eye development: a link between FGF and MITF.
10830168 2000 Crystal structures of two FGF-FGFR complexes reveal the determinants of ligand-receptor specificity.
10736564 2000 Production and characterization of the extracellular domain of recombinant human fibroblast growth factor receptor 4.
10618369 2000 Structural interactions of fibroblast growth factor receptor with its ligands.
10579907 1999 Phospholipase C-gamma as a signal-transducing element.
10574949 1999 Mapping ligand binding domains in chimeric fibroblast growth factor receptor molecules. Multiple regions determine ligand binding specificity.
10510314 1999 Fibroblast growth factor-1 interacts with the glucose-regulated protein GRP75/mortalin.
10373120 1999 Initiation of mammalian liver development from endoderm by fibroblast growth factors.
10336501 1999 Specificity for fibroblast growth factors determined by heparan sulfate in a binary complex with the receptor kinase.
10206481 1999 Alteration of fibroblast growth factor and receptor expression after acute pancreatitis in humans.
9806903 1998 Cloning of an intracellular protein that binds selectively to mitogenic acidic fibroblast growth factor.
9719643 1998 Solution structure of acidic fibroblast growth factor bound to 1,3, 6-naphthalenetrisulfonate: a minimal model for the anti-tumoral action of suramins and suradistas.
9712836 1998 S100A13 is involved in the regulation of fibroblast growth factor-1 and p40 synaptotagmin-1 release in vitro.
9655399 1998 Structure of a heparin-linked biologically active dimer of fibroblast growth factor.
9630568 1998 Production and oestrogen regulation of FGF1 in normal and cancer breast cells.
9501919 1998 Glutathione depletion associated with the HIV-1 TAT protein mediates the extracellular appearance of acidic fibroblast growth factor.
9139660 1997 Structures of the tyrosine kinase domain of fibroblast growth factor receptor in complex with inhibitors.
8976296 1997 Expression of fibroblast growth factors (FGFs) and FGF receptors in human prostate.
8950275 1996 Three-dimensional structure of acidic fibroblast growth factor in solution: effects of binding to a heparin functional analog.
8679713 1996 Serum-starvation induces the extracellular appearance of FGF-1.
8663044 1996 Receptor specificity of the fibroblast growth factor family.
8652550 1996 X-ray crystal structure of human acidic fibroblast growth factor.
8622701 1996 Identification of six novel autophosphorylation sites on fibroblast growth factor receptor 1 and elucidation of their importance in receptor activation and signal transduction.
7681435 1993 Immunohistochemical localization of acidic and basic fibroblast growth factors in normal human endometrium and endometriosis and the detection of their mRNA by polymerase chain reaction.
7680120 1993 Cloning of two novel forms of human acidic fibroblast growth factor (aFGF) mRNA.
7678925 1993 Gene structure and differential expression of acidic fibroblast growth factor mRNA: identification and distribution of four different transcripts.
7542239 1995 The HIV-1 TAT protein induces the expression and extracellular appearance of acidic fibroblast growth factor.
7533902 1995 Human fibroblast growth factor 1 gene expression in vascular smooth muscle cells is modulated via an alternate promoter in response to serum and phorbol ester.
7521397 1994 1H-NMR assignment and solution structure of human acidic fibroblast growth factor activated by inositol hexasulfate.
7504343 1993 The expression of acidic fibroblast growth factor (heparin-binding growth factor-1) and cytokine genes in human cardiac allografts and T cells.
3964259 1986 Human brain-derived acidic and basic fibroblast growth factors: amino terminal sequences and specific mitogenic activities.
3778488 1986 Amino acid sequence of human acidic fibroblast growth factor.
3732516 1986 Partial molecular characterization of endothelial cell mitogens from human brain: acidic and basic fibroblast growth factors.
3527167 1986 The complete amino acid sequence of human brain-derived acidic fibroblast growth factor.
3523756 1986 Human endothelial cell growth factor: cloning, nucleotide sequence, and chromosome localization.
2590193 1989 Structural analysis of the gene for human acidic fibroblast growth factor.
2474753 1989 Cloning of the gene coding for human class 1 heparin-binding growth factor and its expression in fetal tissues.
2444975 1987 Human vascular smooth muscle cells both express and respond to heparin-binding growth factor I (endothelial cell growth factor).
2427112 1986 Human class 1 heparin-binding growth factor: structure and homology to bovine acidic brain fibroblast growth factor.
2393407 1990 The gene for human acidic fibroblast growth factor encodes two upstream exons alternatively spliced to the first coding exon.
1885605 1991 Characterization and molecular cloning of a putative binding protein for heparin-binding growth factors.
1720622 1991 Single primer-mediated polymerase chain reaction: application in cloning of two different 5'-untranslated sequences of acidic fibroblast growth factor mRNA.
1717925 1991 Cloning and sequence analysis of the human acidic fibroblast growth factor gene and its preservation in leukemia patients.
1702556 1991 Three-dimensional structures of acidic and basic fibroblast growth factors.
1697263 1990 Cloning and expression of two distinct high-affinity receptors cross-reacting with acidic and basic fibroblast growth factors.
1693186 1990 Alternative splicing generates two forms of mRNA coding for human heparin-binding growth factor 1.
1372643 1992 An acidic fibroblast growth factor protein generated by alternate splicing acts like an antagonist.