Property Summary

NCBI Gene PubMed Count 27
PubMed Score 19.80
PubTator Score 19.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
aldosterone-producing adenoma -1.013 1.6e-02
atypical teratoid / rhabdoid tumor 1.700 8.0e-04
Breast cancer -1.100 2.4e-07
cystic fibrosis -2.886 3.3e-07
ductal carcinoma in situ -1.200 6.6e-04
Endometriosis -1.048 3.8e-02
gastric carcinoma -1.600 1.8e-02
group 4 medulloblastoma 2.500 1.7e-04
intraductal papillary-mucinous adenoma (... 2.100 8.9e-04
intraductal papillary-mucinous carcinoma... 1.600 6.6e-03
invasive ductal carcinoma -1.800 4.2e-04
lung adenocarcinoma -1.600 4.7e-11
medulloblastoma, large-cell 1.500 8.4e-03
mucosa-associated lymphoid tissue lympho... 1.140 1.4e-02
non-small cell lung cancer -1.780 2.4e-23
osteosarcoma -3.411 1.4e-06
Pick disease 1.500 8.1e-06
psoriasis -1.200 1.1e-09

Protein-protein Interaction (1)

Gene RIF (14)

AA Sequence

MEEIKPASASCVSKEKPSKVSDLISRFEGGSSLSNYSDLKKESAVNLNAPRTPGRHGLTTTPQQKLLSQH      1 - 70
LPQRQGNDTDKTQGAQTCVANGVMAAQNQMECEEEKAATLSSDTSIQASEPLLDTHIVNGERDETATAPA     71 - 140
SPTTDSCDGNASDSSYRTPGIGPVLPLEERGAETETKVQERENGESPLELEQLDQHHEMKETNEQKLHKI    141 - 210
ANELLLTERAYVNRLDLLDQVFYCKLLEEANRGSFPAEMVNKIFSNISSINAFHSKFLLPELEKRMQEWE    211 - 280
TTPRIGDILQKLAPFLKMYGEYVKGFDNAMELVKNMTERIPQFKSVVEEIQKQKICGSLTLQHHMLEPVQ    281 - 350
RIPRYEMLLKDYLRKLPPDSLDWNDAKKSLEIISTAASHSNSAIRKMENLKKLLEIYEMLGEEEDIVNPS    351 - 420
NELIKEGQILKLAARNTSAQERYLFLFNNMLLYCVPKFSLVGSKFTVRTRVGIDGMKIVETQNEEYPHTF    421 - 490
QVSGKERTLELQASSAQDKEEWIKALQETIDAFHQRHETFRNAIAKDNDIHSEVSTAELGKRAPRWIRDN    491 - 560
EVTMCMKCKEPFNALTRRRHHCRACGYVVCWKCSDYKAQLEYDGGKLSKVCKDCYQIISGFTDSEEKKRK    561 - 630
GILEIESAEVSGNSVVCSFLQYMEKSKPWQKAWCVIPKQDPLVLYMYGAPQDVRAQATIPLLGYVVDEMP    631 - 700
RSADLPHSFKLTQSKSVHSFAADSEELKQKWLKVILLAVTGETPGGPNEHPATLDDHPEPKKKSEC        701 - 766
//

Text Mined References (26)

PMID Year Title