Property Summary

NCBI Gene PubMed Count 361
PubMed Score 111.35
PubTator Score 15551.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -4.042 1.3e-02
lung adenocarcinoma 1.500 1.7e-03

Gene RIF (314)

PMID Text
27044366 Neutrophilic asthma patients and eosinophilic asthma patients had increased fibrinogen compared to controls.
26317125 desAB fibrin binds to prothrombin through the Bbeta26-42 amino acid residues and the formation of such a complex causes a non-enzymatic activation of prothrombin
26308135 Here we report a new B[beta] gene mutation (Fibrinogen St Kilda) identified in two Caucasian sisters with reduced fibrinogen level (1.2-1.6 g/L) during investigation for recurrent early miscarriages.
26077345 Strong positive association has been found between betatrophin, plasma fibrinogen (FBG), and insulin resistance in non-diabetic subjects. Correlations with FBG and insulin resistance were diminished in type 2 diabetes subjects.
26011420 This prospective study in 110 patients undergoing major cardiovascular surgery at risk of post-cardiopulmonary bypass bleeding compares fibrinogen level.
26006300 These experiments demonstrate, for the FGB-p.Asp185Asn mutation, a pathogenic mechanism not common for fibrinogen deficiencies, i.e. the hyperglycosylation of the Bbeta chain due to the introduction of a novel N-glycosylation motif.
25981141 The study reports two novel mutations detected in the FGA and FGB genes in two patients with inherited hypofibrinogenemia.
25896470 High plasma fibrinogen levels and platelet count are associated with esophageal squamous cell carcinoma.
25890854 Results suggest that FGB -148 C/T and -854 G/A polymorphisms probably contribute to susceptibility of ischemic stroke in Chinese population.
25867317 In the present study, we found that the -148C>T polymorphism in the FGB gene was significantly associated with ischemic stroke in a Chinese population [meta-analysis]
25809477 FXIII-B plays important roles in the formation of a ternary complex between proenzyme FXIII, prosubstrate fibrinogen, and activator thrombin
25555432 An analysis of the results obtained in this study and a critical review of previously published data indicate that gene polymorphisms in FGA and FGB are not related to ischemic stroke in children
25413489 the NGR motif in fibrinogen is the site that is primarily responsible for the interaction with resting alphaIIbbeta3 and is responsible for triggering platelet activation
25398500 The results of the meta-analysis indicate that the -455 G>A polymorphism in the beta-fibrinogen gene is a susceptibility marker of ischemic cerebral infarction in the Chinese population.
25384698 Elevated fibrinogen levels are associated with negative tumor response to therapy in rectal cancer.
25280629 Results show that oxidized fibrinogen, instead of serum albumin (HSA), is the key protein for intermolecular dityrosine formation in plasma.
25204086 High fibrinogen levels are associated with gynecologic cancer.
24957141 The A + genotype of the FGB -455 G/A polymorphism associated with poor survival among 55-71 years old Caucasian women in the Finnish stroke cohort.
24803720 Plasma fibrinogen is an independent predictor for the severity of coronary artery disease in diabetic patients.
24720800 results of our meta-analysis suggested that the-148C>T polymorphism in the FGB gene is a susceptibility marker of ischemic stroke
24560896 Four novel FGB mutations were identified in two afibrinogenemic (one new-born and one 30 years old male) and hypofibrinogenemic (a 49 years old female) patient, with heterogeneous thrombotic and bleeding phenotype
24531853 plasma fibrinogen increase during ischemic stroke has a role in worse outcome
24466284 Elevated fibrinogen is associated with idiopathic sudden hearing loss.
24448059 meta-analysis suggests that the FGB-455G/A polymorphism contributes to susceptibility to ischemic stroke and coronary heart disease
24366241 results indicate that FGbeta-455G/A polymorphism may be a susceptible predictor of ischemic stroke [meta-analysis]
24040290 Stepwise assembly of fibrinogen is assisted by the endoplasmic reticulum ERp57 lectin-chaperone system in a human hepatocyte cell line.
23969696 We identify 23 robustly associated fibrinogen loci, 15 of which are new, but no support for a causal relationship between circulating levels of fibrinogen and coronary artery disease, stroke, or venous thromboembolism.
23958299 human serum albumin influences glycation of fibrinogen
23931975 Both fibrinogen polymorphisms are capable to modify the atherosclerotic process via their effects on the coagulation cascade.
23877568 These results indicate that DPT can modify certain biological functions of fibrin, and thus a another function of this extracellular matrix protein was revealed.
23852822 Studies indicate that in afibrinogenemia and hypofibrinogenemia, most mutations of the FGA, FGB, or FGG fibrinogen encoding genes are null mutations.
23650004 The beta-fibrinogen -455G/A gene polymorphism is not a risk factor for ischaemic stroke in a Polish population.
23238100 Fibrinopeptide A release is necessary for effective B:b interactions during polymerisation of variant fibrinogens with impaired A:a interactions.
23129316 A meta-analysis of a Chinese population found that the FgB -455G/A and the -148C/T gene polymorphism was implied to be associated with coronary artery disease susceptibility.
23061815 Patients with heritable dysfibrinogenaemia and harbouring a candidate single nucleotide variations within highly restricted regions of the FGN genes had similar laboratory features irrespective of genotype.
23056168 Data indicate that PDGF enhances the adhesion of CD44v-coated beads to immobilized fibrin(ogen).
22889670 Both isoforms of the beta-chain of FIB discovered by 2D-gel electrophoresis are decreased in the Parkinson's disease group cerebrospinal fluid, compared to normal controls.
22836683 Regulation of the fibrinogen genes from proximal promoters and enhancers, the influence of acute-phase stimulation, post-transcriptional regulation by miRNAs and functional regulatory variants identified in genetic studies. Review.
22642105 we observed association of ischemic stroke with allele/genotype combinations of genes IL6, FGA and FGB, in which IL6 plays key role and FGA and FGB have modulating function.
22575419 Lys, as an inhibitor of protein glycation, improved fibrinogen's structure and function, both in vitro and in vivo.
22552295 Streptococcus gordonii FSS2 Challisin affects fibrin clot formation by digestion of the alphaC region and cleavage of the N -terminal region of the Bbeta chains of fibrinogen
22489912 Impaired lung function is a correlate of fibrinogen levels and the presence of higher fibrinogen levels increases the risk of mortality both in the overall population and among subjects with COPD.
22386478 Fibrinogen polymorphisms contributes to the association between common variants in the fibrinogen gene and the risk of developing sporadic cerebral hemorrhage.
22293628 Levels of fibrinogen and thromboelastometry fibrin polymerisation following treatment with desmopressin (DDAVP).
22273812 genetic polymorphism is associated with plasma fibrinogen levels and haematological traits in whites, blacks and mexican americans
22053176 Fibrinogen has chaperone activity which is compromised upon glycation by methylglyoxal.
21800007 increased fibrinogen concentration in black South Africans, especially in rural areas
21725578 genetic polymorphism is associated with delayed clot formation and more permeable fibrin network
21713329 mutation presents as hypodysfibrinogenaemia due to alterations in sialic acid content
21499712 study found that -C148T FGB polymorphism was an independent predictor of pre- and early postoperative C-reactive protein levels in coronary artery bypass graft patients
21420681 LRP1b shows restricted expression in human tissues and binds to several extracellular ligands, including fibrinogen and apoE--carrying lipoproteins
21316837 Clinical manifestations of acute focal neurological deficits in stroke were associated with plasma antithrombin-III and fibrinogen
21296900 Patients with atherothrombotic stroke showed raised fibrinogen and erythrocyte sedimentation rate
21258858 analysis of fibrinogen and cognitive performance in three Scottish cohorts
21241403 The BF -455G/A polymorphisms was found to be positively.
21160146 The allele frequencies for beta fibrinogen were similar between women with recurrent pregnancy loss and control women, suggesting that the effect of beta-fibrinogen polymorphisms on recurrent miscarriages, if any, is actually very slight.
21122273 The beta-fibrinogen -455 G>A gene polymorphism is associated with peripheral vascular injury in systemic sclerosis patients.
21098282 Data suggest that the interaction between Abeta and fibrinogen may be an important contributor to the vascular abnormalities found in Alzheimer's disease.
21054877 Observational study of gene-disease association. (HuGE Navigator)
21034162 Observational study of gene-disease association. (HuGE Navigator)
20978265 Fibrinogen gene single nucleotide polymorphisms are associated with cardiovascular diseases.
20873219 Polymorphic markers G(-455)A of gene FGB and C(-1654)T of gene PROC and genetic predisposition to unfavorable outcomes patients undergoing acute coronary syndrome
20709368 Observational study of gene-disease association. (HuGE Navigator)
20673868 Observational study of gene-disease association. (HuGE Navigator)
20637145 Plasma fibrinogen levels and fibrinogen Bbeta-148C/T polymorphism are associated with coronary artery lesions in children with Kawasaki disease.
20637145 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20619835 fibrinogen and thrombin may have a role in hemostatic alterations in overweight children
20538554 Observational study of gene-disease association. (HuGE Navigator)
20536507 Observational study of gene-disease association. (HuGE Navigator)
20535834 The beta-chain of fibrinogen level was found significant risk factor only for the venous thrombosis group.
20535834 Observational study of gene-disease association. (HuGE Navigator)
20533267 There was FGA gene 128C/G polymorphism in the Hunan Han population. There was no association of this polymorphism with the increased Fg level of CI patient in the population.
20452482 Observational study of gene-disease association. (HuGE Navigator)
20425806 Observational study of gene-disease association. (HuGE Navigator)
20376805 The B beta -455 and -249 mutated genotypes are accumulative genes for overweight by regulating the fibrinogen function.
20376805 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20167083 FGB rs1800787 and rs1800789 SNPs seem to confer protection to coronary artery disease onset, lowering the risk by about 50% in homozygotes for the minor alleles.
20167083 Observational study of gene-disease association. (HuGE Navigator)
20162731 we identified FBG-beta as a hepatitis C virus (HCV) core interacting protein by screening a human liver complementary DNA (cDNA) library
20135074 The SNP rs4220 in FGB , which leads to the substitution of arginine by lysine at position 448, is independently associated with plasma fibrinogen level and hypertension in Hong Kong Chinese men.
20128871 Observational study of gene-disease association. (HuGE Navigator)
20082208 Observational study of gene-disease association. (HuGE Navigator)
20079495 fibrinogen may have a role in progression of coronary artery calcification in adults with type 1 diabetes
20078877 Observational study of gene-disease association. (HuGE Navigator)
20075509 Elevated levels of C-reactive protein and fibrinogen and reduced level of adiponectin can be used for early diagnosis of type 2 diabetes mellitus and can predict diabetic complications.
20064497 Observational study of gene-disease association. (HuGE Navigator)
20059469 Although IL-6 responsive binding sites are present in fibrinogen gene promoter regions, we did not find strong evidence of interaction between fibrinogen SNPs and IL6 SNPs or levels influencing CVD.
20059469 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20051843 Observational study of gene-disease association. (HuGE Navigator)
20036902 Observational study of gene-disease association. (HuGE Navigator)
20031576 A single-nucleotide polymorphism in the FGB is a risk factor for cardiovascular Diseases.
20031576 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19956635 Uncategorized study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19954614 FgB beta Bcl-1A allele and variation genotype were susceptible to cerebral infarction.
19954614 Observational study of gene-disease association. (HuGE Navigator)
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19923980 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19906129 Observational study of gene-disease association. (HuGE Navigator)
19899640 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19892918 Observational study of gene-disease association. (HuGE Navigator)
19860767 Observational study of gene-disease association. (HuGE Navigator)
19811441 the association of the -455G/A polymorphism with higher fibrinogen levels may actually be due to linkage disequilibrium between the -455G/A polymorphism and other truly functional polymorphisms.
19750100 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19682239 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19593947 Observational study of gene-disease association. (HuGE Navigator)
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19560472 Observational study of gene-disease association. (HuGE Navigator)
19559392 Observational study of gene-disease association. (HuGE Navigator)
19508823 The fibrinogen gene polymorphism (Bbeta-148C/T) affects plasma fibrinogen concentration. And the fibrinogen gene polymorphism (Bbeta-148C/T) may be related with cerebral infarction in Uygur patients of China.
19479237 Observational study of gene-disease association. (HuGE Navigator)
19431272 Among stroke patients, carriers of an -148T allele had significantly higher plasma fibrinogen level and platelet aggregation to norepinephrin compared to the C/C homozygotes.
19420351 Observational study of gene-disease association. (HuGE Navigator)
19420105 Observational study of gene-disease association. (HuGE Navigator)
19409601 G-455A polymorphism of beta-fibrinogen gene and the risk of premature myocardial infarction in Greece is reported.
19409601 Observational study of gene-disease association. (HuGE Navigator)
19404555 Case Report: Two novel mutations at contiguous codons in the fibrinogen Bbeta chain associated with hypofibrinogenaemia.
19395327 Observational study of gene-disease association. (HuGE Navigator)
19352213 There was evidence of pharmacogenetic effects of FGB-455 on stroke, ESRD, and mortality, suggesting that relative to those homozygous for the common allele, variant allele carriers of the FGB gene
19332210 Observational study of gene-disease association. (HuGE Navigator)
19272152 Observational study of gene-disease association. (HuGE Navigator)
19264644 The ORF3-fibrinogen Bbeta interaction was verified by co-immunoprecipitation and fluorescence resonance energy transfer in mammalian cells.
19238444 HuGE review of gene-disease association and gene-environment interaction. (HuGE Navigator)
19229055 Mechanistically the 15-nucleotide deletion fibrinogen (Bbeta Asn167_Glu171del) associated with bleeding appears to arise from replication advancement during DNA synthesis caused by a flanking pentanucleotide repeat of AATGA.
19227305 Carriage of FGB-455A, grade II mitral regurgitation, and AF longer than 48 hours are assumed to be independent predictors of thromboembolic stroke.
19227305 Observational study of gene-disease association. (HuGE Navigator)
19190816 Observational study of gene-disease association. (HuGE Navigator)
19143925 The FGA Thr312Ala single-nucleotide polymorphism (SNP) was associated with a decrease in risk of ischemic stroke
19143925 Observational study of gene-disease association. (HuGE Navigator)
19136375 Observational study of gene-disease association. (HuGE Navigator)
19131662 Meta-analysis of gene-disease association. (HuGE Navigator)
19072566 Observational study of genotype prevalence. (HuGE Navigator)
19056482 Observational study of gene-disease association. (HuGE Navigator)
18982866 individuals carrying the fibrinogen beta-chain 448K allele may be protective against having myocardial infarction in this population.
18982866 Observational study of gene-disease association. (HuGE Navigator)
18977990 Observational study of gene-disease association. (HuGE Navigator)
18974842 Observational study of gene-disease association. (HuGE Navigator)
18936436 Observational study of genotype prevalence. (HuGE Navigator)
18930220 Observational study of gene-disease association. (HuGE Navigator)
18927546 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18853456 homozygous point mutation (FGB c.115-600A>G) within intron 1 causes the inclusion of a 50-bp cryptic exon by creating a consensus heptad motif recognized by the spliceosome recruiting protein pre-mRNA splicing factor
18848323 Observational study of gene-disease association. (HuGE Navigator)
18842294 Observational study of gene-disease association. (HuGE Navigator)
18841297 novel BbetaA277V mutation causes low normal plasma fibrinogen
18836720 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18818200 Fibrinogen beta-chain tyrosine nitration may have a role in thrombosis
18803625 Observational study of gene-disease association. (HuGE Navigator)
18772067 Common single nucleotide polymorphisms and haplotypes explain the interindividual and intraindividual variability of fibrinogen levels, in patients with a history of myocardial infarction.
18772067 Observational study of gene-disease association. (HuGE Navigator)
18726528 Results suggest the absence of an association between beta-fibrinogen gene -148C/T polymorphism and coronary artery disease, and the possibility that -455G/A polymorphism increases susceptibility to this disease in the Chinese population.
18726528 Meta-analysis of gene-disease association. (HuGE Navigator)
18685811 A higher frequency of Beta-Fibrinogen -455G-A mutation was observed in patients, but this difference did not reach a statistical significance.
18683729 Fg-beta455 G/A polymorphism may contribute to elevated plasma fibrinogen levels and put individuals at higher risk of having severe periodontitis.
18683729 Observational study of gene-disease association. (HuGE Navigator)
18513389 Observational study of gene-disease association. (HuGE Navigator)
18511872 Meta-analysis of gene-disease association. (HuGE Navigator)
18503143 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18434720 This study demonstrates that the plasma fibrinogen level, but not fibrinogen beta148 and beta854 genotypes, was associated with CHD in the Chinese population.
18434720 Observational study of gene-disease association. (HuGE Navigator)
18334738 Observational study of gene-disease association. (HuGE Navigator)
18331453 Observational study of gene-disease association. (HuGE Navigator)
18284606 Observational study of gene-disease association. (HuGE Navigator)
18278190 While fibrinogen genetic variation was strongly associated with fibrinogen levels, there was less evidence of association with the more complex outcomes of cardiovascular disease.
18278190 Observational study of gene-disease association. (HuGE Navigator)
18253477 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18202324 examined the association of haplotypes in the 50-kb fibrinogen gene region with myocardial infarction in 2 large case-control samples
18202324 Observational study of gene-disease association. (HuGE Navigator)
18188987 Meta-analysis of gene-disease association. (HuGE Navigator)
18188987 beta-fibrinogen gene -455G/A polymorphism might contribute to susceptibility of cerebral infarction in Chinese population; allele A increases the individual susceptibility to the disease
18173921 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18057060 Observational study of gene-disease association. (HuGE Navigator)
18000621 HETEROZGOUS POINT MUTATIONS IN BOTH THE FGG AND FGB CHAINS OF FIBRINOGEN CAUSING HYPOFIBRINOGENEMIA IN FAMILY MEMBERS
17994314 Observational study of gene-disease association. (HuGE Navigator)
17951283 No significant association was found between the fibrinogen beta haplotypes and cerebral small vessel disease.
17925485 Fibrinogen BbetaArg448Lys is a primary example of common genetic variation with a significant phenotypic effect at the molecular level.
17849064 Identify fibrinogen Bbeta mutations in patients evaluated for hypofibrinogenemia.
17688324 The peptides GPRPam and GPRPYam, which are surrogate A-knobs, were tested for their influence on fibrin polymerization with fibrinogen from lamprey and humans.
17637253 Meta-analysis of gene-disease association. (HuGE Navigator)
17637253 study shows that beta-fibrinogen gene -148C/T polymorphism might contribute to susceptibility to cerebral infarction in Han Chinese
17591786 The A alpha and B beta chains of fibrinogen, but not the gamma chains, are specifically recognized by Treponema denticola ATCC 35405, which may promote colonization and modulate hemostasis.
17582472 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17497226 Lebanese individuals were found to have a relatively high prevalence of the A allele which may predispose them to develop cardiovascular diseases as well as thrombotic events
17497226 Observational study of genotype prevalence. (HuGE Navigator)
17469143 Observational study of gene-disease association. (HuGE Navigator)
17469143 Our findings suggest that risk of glomerular microthrombosis in lupus nephritis is attributable, at least in part, to an epistatic effect of PAI-1 and FGB genes.
17414213 REVIEW: the N-terminus of Bbeta, the C-terminus of Aalpha, and the splice variant gamma' modulate fibrin clot structure
17264952 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17263791 Observational study of gene-disease association. (HuGE Navigator)
17230042 Observational study of gene-disease association. (HuGE Navigator)
17160939 Observational study of gene-disease association. (HuGE Navigator)
17126309 Observational study of gene-disease association. (HuGE Navigator)
17126309 nitric oxide synthase 3 is also related to hypertension, endothelial dysfunction and variation on serum cholesterol in young adults with acute myocardial infarction
17116333 Observational study of gene-disease association. (HuGE Navigator)
17116333 carriage of the GAA haplotype in FGB is associated with decreased mortality and less organ dysfunction in a cohort of critically ill patients with sepsis
17115186 Observational study of gene-disease association. (HuGE Navigator)
17115186 Association of fibrinogen beta single nucleotide polymorphism FGB(-455) with severe caroltid artery disease is confirmed.
17111197 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17003923 Observational study of genotype prevalence. (HuGE Navigator)
16953282 analysis of a novel fibrinogen Bbeta Arg264gly substitution causing hypofibrinogenaemia
16940416 For the first time B:b binding is demonstrated to be mediated by natural B-knobs exposed in a fibrin monomer.
16938111 Observational study of gene-disease association. (HuGE Navigator)
16928957 Flow induced alpha2beta1 activation in cells on collagen, but not on fibronectin or fibrinogen. Conversely, alpha5beta1 and alphavbeta3 are activated on fibronectin and fibrinogen, but not collagen.
16899909 Observational study of gene-disease association. (HuGE Navigator)
16899909 findings support the notion that the homozigous variant of beta-FIB gene can raise both plasma FIB concentration and whole blood viscosity
16776623 Observational study of gene-disease association. (HuGE Navigator)
16767673 Results of multi-allele and haplotype analysis indicated that the polymorphisms -455 G/A, -148 C/T, 448 G/A in beta fibrinogen gene were the possible risk factors associated with the occurrence of ischemic stroke in Hainan Han population.
16767673 Observational study of gene-disease association. (HuGE Navigator)
16750002 There was a complete linkage disequilibrium between fibrinogen beta -148C/T and -455G/A found in Han population with pulmonary thrmoboembolism.
16750002 Observational study of gene-disease association. (HuGE Navigator)
16706972 Observational study of gene-disease association. (HuGE Navigator)
16697386 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16697386 results concord with the already shown link between fibrinogen concentration & fasting insulin concentration (FIC) & support the hypothesis of relationship between fibrinogen & endothelium in FIC homeostasis whose alteration may induce metabolic disorders
16635210 Observational study of gene-disease association. (HuGE Navigator)
16614319 Observational study of gene-disease association. (HuGE Navigator)
16611940 In this work we report the identification of a strong SF2/ASF binding site within exon 7 of the human fibrinogen Bbeta-chain gene (FGB).
16604498 Observational study of gene-disease association. (HuGE Navigator)
16601848 analysis of hypofibrinogenaemia resulting from novel single nucleotide deletion at codon Bbeta58
16567932 Observational study of gene-disease association. (HuGE Navigator)
16525569 Observational study of gene-disease association. (HuGE Navigator)
16525568 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16489740 We hypothesize that the modification of lysine by Hcys thiolactone might occur in vivo, lead to abnormal resistance of clots to lysis, and thereby contribute to the prothrombotic state associated with homocysteinemia.
16466010 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16443328 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
16420563 Observational study of gene-disease association. (HuGE Navigator)
16409729 Observational study of gene-disease association. (HuGE Navigator)
16353042 Observational study of gene-disease association. (HuGE Navigator)
16324093 Observational study of gene-disease association. (HuGE Navigator)
16215953 FgB beta -148 and 448 mutational genotypes have impact on Fg concentrationi and therefore increase the risk of infarction.
16215953 Observational study of gene-disease association. (HuGE Navigator)
16195396 Truncation of the seven most C-terminal residues (R455-Q461) of the Bbeta chain specifically inhibits fibrinogen secretion.
16157382 Observational study of gene-disease association. (HuGE Navigator)
16144795 Observational study of gene-disease association. (HuGE Navigator)
16086292 Observational study of gene-disease association. (HuGE Navigator)
16080811 Observational study of gene-disease association. (HuGE Navigator)
16049588 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15983960 Observational study of gene-disease association. (HuGE Navigator)
15968394 Observational study of gene-disease association. (HuGE Navigator)
15939070 Observational study of gene-disease association. (HuGE Navigator)
15857159 Observational study of gene-disease association. (HuGE Navigator)
15842357 Bbeta-Leu353Arg is associated with impaired fibrinogen secretion, but not with hepatic endoplasmic reticulum storage disease
15795540 Observational study of genotype prevalence. (HuGE Navigator)
15795538 Observational study of gene-disease association. (HuGE Navigator)
15793786 Dysfibrinogenemia in the family is caused by Arg275His in the beta chain of fibrinogen and it is the first report on a Chinese family with inherited dysfibrinogenemia.
15737987 the HNF-3 site in the fibrinogen beta promoter is important for IL6-induced expression, and its activity is influenced by the adjacent -148C/T polymorphism
15735812 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15735811 Observational study of gene-disease association. (HuGE Navigator)
15709716 Observational study of gene-disease association. (HuGE Navigator)
15671034 the basal expression of gamma-fibrinogen is regulated by a constitutive transcriptional repressor protein, hnRNP A1, and the decreased binding activity of hnRNP A1 leads to the overexpression of gamma chain in HepG2 cells that overexpress the Bbeta chain
15631828 Observational study of gene-disease association. (HuGE Navigator)
15608011 Observational study of gene-disease association. (HuGE Navigator)
15583729 Observational study of gene-disease association. (HuGE Navigator)
15583729 a beta-fibrinogen polymorphism may have a role in myocardial infarction
15575509 Observational study of gene-disease association. (HuGE Navigator)
15346842 Observational study of gene-disease association. (HuGE Navigator)
15300640 The study demonstrates that A allele of the B beta gene FGB -455G/A polymorphism may be a susceptible predictor of the occurrence of ACI, particularly in smokers.
15300640 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15217804 Review. Genetic and environmental factors alter fibrin structure and function. This has implications for the clinical presentation of vascular disease.
15213870 Erythrocyte aggregation and -455G/A polymorphism of the beta-fibrinogen gene in survivors of acute myocardial infarction.
15192836 Observational study of gene-disease association. (HuGE Navigator)
15170397 Observational study of gene-disease association. (HuGE Navigator)
15104216 Observational study of gene-disease association. (HuGE Navigator)
15091001 Observational study of gene-disease association. (HuGE Navigator)
15076187 Observational study of gene-disease association. (HuGE Navigator)
14963283 Observational study of gene-disease association. (HuGE Navigator)
14746139 Observational study of genotype prevalence. (HuGE Navigator)
14706682 Observational study of gene-disease association. (HuGE Navigator)
14691567 the C-terminal sequences of the beta and gamma chains of fibrinogen have roles in fibrin polymerization as well as in cell attachment
14669221 Observational study of genotype prevalence. (HuGE Navigator)
14652632 Observational study of gene-disease association. (HuGE Navigator)
14652632 results demonstrate that the FGB beta -455 G/A polymorphism is not associated with myocardial infarction and the closely linked B beta Arg448Lys protein coding variation does not influence function nor structure of the protein in a purified system.
14629469 a heterozygous single point mutation of T-->G at position 3356 of the patient fibrinogen Bbeta chain gene resulted in a nonsense mutation, and also resulted in a new NheI recognition sequence at this position
14629463 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
14629463 suggest a possible interactive effect of cigarette smoke and the b fibrinogen gene G-455-A polymorphism in the risk of developing Legg-Perthes disease
14618197 Observational study of gene-disease association. (HuGE Navigator)
14618197 Polymorphism of BclI betaFbg gene is associated with an increased fibrinogen plasma level. 2. There is no association between BclI polymorphism of betaFbg gene and the number of affected coronary arteries
12899665 Observational study of gene-disease association. (HuGE Navigator)
12893758 Fibrinogen molecules from a compound FGB heterozygote with an N-terminal nonsense mutation W47X (exon 2) & a missense mutation (G444S, exon 8), can assemble but are not secreted, confirming the need for an intact FGB C-terminal domain for secretion.
12871600 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
12747593 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12716802 Observational study of gene-disease association. (HuGE Navigator)
12710752 Observational study of gene-disease association. (HuGE Navigator)
12637691 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12637691 Fibrinogen gene promoter -455 A allele as a risk factor for lacunar stroke.
12617173 review of details of the structure, binding interactions, and function of each of the fibrinogen chains, FGA, FGB, FGG
12616980 Clinical trial of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12615788 Observational study of gene-disease association. (HuGE Navigator)
12578626 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12518110 Observational study of genotype prevalence. (HuGE Navigator)
12514663 Observational study of gene-disease association. (HuGE Navigator)
12514663 frequencies of the beta-fibrinogen 448 A allele were higher in patients with no flow-limiting stenosis after myocardial infarction
12511408 The first prenatal diagnosis for afibrinogenemia found a novel nonsense mutation in the FGB gene, Trp467Stop (W467X). This confirms the need for intact C-terminal portions of FGB for the secretion of functional hexamers.
12406024 Observational study of gene-disease association. (HuGE Navigator)
12393540 2 new homozygous mutations in introns 6 & 7 represent the first Bbeta-chain splicing mutations in afibrinogenemia. IVS6 + 13C > T creates a donor splice site in intron 6. IVS7 + 1G >T removes the invariant GT of intron 7 donor splice site.
12161363 Among Iranian afirbinogenemia patients, for the first time, a nonsense mutation (3282C-->T) was found in exon 2 of the fibrinogen Bbeta-chain gene, causing truncation of the corresponding polypeptide.
12151156 Observational study of gene-disease association. (HuGE Navigator)
12141403 Observational study of gene-disease association. (HuGE Navigator)
12122980 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12082592 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
12082590 Observational study of gene-disease association. (HuGE Navigator)
12048138 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
11940334 Observational study of gene-disease association. (HuGE Navigator)
11877019 Observational study of gene-disease association. (HuGE Navigator)
11858186 There was no effect of the -854G>A beta-fibrinogen promoter polymorphism on fibrinogen, but the fibrinogen -455G>A polymorphism increased fibrinogen levels following exercise. The genotype might be clinically relevant at times of hyperfibrinogenaemia.
11836675 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11798781 Observational study of gene-disease association. (HuGE Navigator)
11728146 Observational study of gene-disease association. (HuGE Navigator)
11714857 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11546832 genotypes are associated with plasma fibrinogen levels in Chinese
11296154 Observational study of genotype prevalence, gene-disease association, and gene-environment interaction. (HuGE Navigator)
11293402 Observational study of gene-disease association. (HuGE Navigator)
11054085 Observational study of gene-disease association. (HuGE Navigator)
11027931 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKRMVSWSFHKLKTMKHLLLLLLCVFLVKSQGVNDNEEGFFSARGHRPLDKKREEAPSLRPAPPPISGGG      1 - 70
YRARPAKAAATQKKVERKAPDAGGCLHADPDLGVLCPTGCQLQEALLQQERPIRNSVDELNNNVEAVSQT     71 - 140
SSSSFQYMYLLKDLWQKRQKQVKDNENVVNEYSSELEKHQLYIDETVNSNIPTNLRVLRSILENLRSKIQ    141 - 210
KLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWT    211 - 280
VIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGD    281 - 350
KVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDP    351 - 420
RKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFFPQ    421 - 490
Q//

Text Mined References (369)

PMID Year Title
27044366 2016 Detailed analysis of sputum and systemic inflammation in asthma phenotypes: are paucigranulocytic asthmatics really non-inflammatory?
26317125 2015 Non-enzymatic activation of prothrombin induced by interaction with fibrin ?26-42 region.
26308135 2015 Novel heterozygous Bbeta (c.1311T>A) mutation (Fibrinogen St Kilda) associated with recurrent pregnancy loss.
26077345 2015 Higher plasma betatrophin/ANGPTL8 level in Type 2 Diabetes subjects does not correlate with blood glucose or insulin resistance.
26011420 2015 Prediction of Post-Weaning Fibrinogen Status during Cardiopulmonary Bypass: An Observational Study in 110 Patients.
26006300 2015 Molecular characterization of 7 patients affected by dys- or hypo-dysfibrinogenemia: Identification of a novel mutation in the fibrinogen Bbeta chain causing a gain of glycosylation.
25981141 2015 Congenital hypofibrinogenemia associated with novel homozygous fibrinogen A? and heterozygous B? chain mutations.
25896470 2015 The clinical significance of preoperative plasma fibrinogen level and platelet count in resectable esophageal squamous cell carcinoma.
25890854 2015 Effect of the -148C/T, 448G/A, and -854G/A Polymorphisms of the ?-Fibrinogen Gene on the Risk of Ischemic Stroke in Chinese Population.
25867317 2015 Association between the FGB gene polymorphism and ischemic stroke: a meta-analysis.
25809477 2015 The Non-catalytic B Subunit of Coagulation Factor XIII Accelerates Fibrin Cross-linking.
25555432 2015 Fibrinogen alpha and beta gene polymorphisms in pediatric stroke--case-control and family based study.
25427968 2015 Clinical and molecular characterisation of 21 patients affected by quantitative fibrinogen deficiency.
25413489 2015 A novel role for the fibrinogen Asn-Gly-Arg (NGR) motif in platelet function.
25398500 2015 A polymorphism (-455G>A) in the ?-fibrinogen gene is associated with an increased risk of cerebral infarction in the Chinese population: A meta-analysis.
25384698 2015 The role of fibrinogen as a predictor in preoperative chemoradiation for rectal cancer.
25280629 2015 A central role for intermolecular dityrosine cross-linking of fibrinogen in high molecular weight advanced oxidation protein product (AOPP) formation.
25204086 2014 Fibrinogen, bFGF and VEGF levels during antibiotic therapy in gynecologic cancer: a preliminary report.
24957141 2014 ?eta-fibrinogen gene promoter A -455 allele associated with poor longterm survival among 55-71 years old Caucasian women in Finnish stroke cohort.
24803720 2014 Association of fibrinogen with severity of stable coronary artery disease in patients with type 2 diabetic mellitus.
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
24720800 2014 FGB gene - 148C>T polymorphism is associated with increased risk of ischemic stroke in a Chinese population: a meta-analysis based on 18 case-control studies.
24560896 2014 FGB mutations leading to congenital quantitative fibrinogen deficiencies: an update and report of four novel mutations.
24531853 2014 The sustained increase of plasma fibrinogen during ischemic stroke predicts worse outcome independently of baseline fibrinogen level.
24466284 2014 Platelet glycoproteins and fibrinogen in recovery from idiopathic sudden hearing loss.
24448059 2014 Influence of the ?-fibrinogen-455G/A polymorphism on development of ischemic stroke and coronary heart disease.
24367264 2013 The Staphylococcus aureus ArlRS two-component system is a novel regulator of agglutination and pathogenesis.
24366241 2014 Genetic polymorphism of ?-fibrinogen gene-455G/A can contribute to the risk of ischemic stroke.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24041635 2013 The role of fibrin matrices and tissue factor in early-term trophoblast proliferation and spreading.
24040290 2013 Stepwise assembly of fibrinogen is assisted by the endoplasmic reticulum lectin-chaperone system in HepG2 cells.
23969696 2013 Multiethnic meta-analysis of genome-wide association studies in >100 000 subjects identifies 23 fibrinogen-associated Loci but no strong evidence of a causal association between circulating fibrinogen and cardiovascular disease.
23958299 2013 A study on human serum albumin influence on glycation of fibrinogen.
23931975 2013 Combined effects of fibrinogen genetic variability on atherosclerosis in patients with or without stable angina pectoris: focus on the coagulation cascade and endothelial function.
23877568 2014 Dermatopontin regulates fibrin formation and its biological activity.
23852822 2013 Congenital fibrinogen disorders: an update.
23650004 The ?-fibrinogen -455G/A gene polymorphism and the risk of ischaemic stroke in a Polish population.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23238100 2013 Fibrinopeptide A release is necessary for effective B:b interactions in polymerisation of variant fibrinogens with impaired A:a interactions.
23144326 2012 Genome-wide association analysis of blood biomarkers in chronic obstructive pulmonary disease.
23129316 2013 Apo A5 -1131T/C, FgB -455G/A, -148C/T, and CETP TaqIB gene polymorphisms and coronary artery disease in the Chinese population: a meta-analysis of 15,055 subjects.
23061815 2013 Clinical phenotype, laboratory features and genotype of 35 patients with heritable dysfibrinogenaemia.
23056168 2012 PDGF suppresses the sulfation of CD44v and potentiates CD44v-mediated binding of colon carcinoma cells to fibrin under flow.
22889670 2012 Cerebrospinal fluid biomarkers of neuropathologically diagnosed Parkinson's disease subjects.
22836683 2012 Fibrinogen gene regulation.
22642105 [Polymorphic variants of genes encoding interleukin-6 and fibrinogen, the risk of ischemic stroke and fibrinogen levels].
22575419 2012 Investigation of the mechanism(s) involved in decreasing increased fibrinogen activity in hyperglycemic conditions using L-lysine supplementation.
22552295 2012 Streptococcus gordonii FSS2 Challisin affects fibrin clot formation by digestion of the ?C region and cleavage of the N -terminal region of the B? chains of fibrinogen.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22489912 2012 Fibrinogen, COPD and mortality in a nationally representative U.S. cohort.
22386478 2012 Fibrinogen polymorphisms associated with sporadic cerebral hemorrhage in a Chinese population.
22293628 2012 Levels of fibrinogen and thromboelastometry fibrin polymerisation following treatment with desmopressin (DDAVP).
22273812 2012 Replication and characterisation of genetic variants in the fibrinogen gene cluster with plasma fibrinogen levels and haematological traits in the Third National Health and Nutrition Examination Survey.
22053176 2011 Beyond genetic factors in familial amyloidotic polyneuropathy: protein glycation and the loss of fibrinogen's chaperone activity.
21800007 2011 Fibrinogen concentration and its role in CVD risk in black South Africans--effect of urbanisation.
21757653 2011 Assessment of genetic determinants of the association of ?' fibrinogen in relation to cardiovascular disease.
21725578 2011 Two different fibrinogen gene mutations associated with bleeding in the same family (A ?Gly13Glu and ?Gly16Ser) and their impact on fibrin clot properties: fibrinogen Krakow II and Krakow III.
21713329 2011 Novel fibrinogen (B ?401Gly?Val) presents as dys- or hypodysfibrinogenaemia due to alterations in sialic acid content.
21499712 2012 Fibrinogen beta-chain -C148T polymorphism is associated with increased fibrinogen, C-reactive protein, and interleukin-6 in patients undergoing coronary artery bypass grafting.
21420681 2011 LRP1b shows restricted expression in human tissues and binds to several extracellular ligands, including fibrinogen and apoE-carrying lipoproteins.
21316837 2011 Antithrombin III associated with fibrinogen predicts the risk of cerebral ischemic stroke.
21296900 2011 Usefulness of measurement of fibrinogen, D-dimer, D-dimer/fibrinogen ratio, C reactive protein and erythrocyte sedimentation rate to assess the pathophysiology and mechanism of ischaemic stroke.
21269460 2011 Initial characterization of the human central proteome.
21258858 2011 Genetic associations between fibrinogen and cognitive performance in three Scottish cohorts.
21241403 2011 Analysis of plasminogen activator inhibitor-1, integrin beta3, beta fibrinogen, and methylenetetrahydrofolate reductase polymorphisms in Iranian women with recurrent pregnancy loss.
21160146 2011 Beta-fibrinogen G-455A polymorphisms and recurrent miscarriage.
21122273 The ?-fibrinogen -455 G>A gene polymorphism is associated with peripheral vascular injury in systemic sclerosis patients.
21098282 2010 Alzheimer's disease peptide beta-amyloid interacts with fibrinogen and induces its oligomerization.
21054877 2010 Inflammation gene variants and susceptibility to albuminuria in the U.S. population: analysis in the Third National Health and Nutrition Examination Survey (NHANES III), 1991-1994.
21034162 2011 Platelet polymorphisms: frequency distribution and association with coronary artery disease in an Indian population.
20978265 2011 Association of genomic loci from a cardiovascular gene SNP array with fibrinogen levels in European Americans and African-Americans from six cohort studies: the Candidate Gene Association Resource (CARe).
20873219 [Polymorphic markers G(-455)A of gene FGB and C(-1654)T of gene PROC and genetic predisposition to unfavorable outcomes patients undergoing acute coronary syndrome].
20709368 2010 The fibrinogen gamma 10034C>T polymorphism is not associated with Peripheral Arterial Disease.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20637145 2010 [Relationship between fibrinogen Bß-148C/T polymorphism and coronary artery lesions in children with Kawasaki disease].
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20619835 2010 Haemostatic alterations in overweight children: associations between metabolic syndrome, thrombin generation, and fibrinogen levels.
20538554 2010 The association of beta-fibrinogen 455 G/A gene polymorphism with left atrial thrombus and severe spontaneous echo contrast in atrial fibrillation.
20536507 2010 Independent predictive roles of eotaxin Ala23Thr, paraoxonase 2 Ser311Cys and beta-adrenergic receptor Trp64Arg polymorphisms on cardiac disease in Type 2 Diabetes--an 8-year prospective cohort analysis of 1297 patients.
20535834 2010 Prevalence of the fibrinogen beta-chain, angiotensin-converting enzyme and plasminogen activator inhibitor-1 polymorphisms in Costa Rican young adults with thrombotic disease.
20533267 2010 [Negative association of FGA gene 128C/G polymorphism with cerebral infarction and its effect on plasma fibrinogen in Hunan Hans].
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20425806 2010 Vascular at-risk genotypes and disease severity in Lebanese sickle cell disease patients.
20376805 2010 [Association of fibrinogen B beta-chain gene polymorphism with factors affecting obesity].
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20167083 2010 Fibrinogen beta variants confer protection against coronary artery disease in a Greek case-control study.
20162731 2010 Hepatitis C virus core protein interacts with fibrinogen-beta and attenuates cytokine stimulated acute-phase response.
20135074 2010 A genetic variant in the gene encoding fibrinogen beta chain predicted development of hypertension in Chinese men.
20128871 2010 Gene variants associated with venous thrombosis: confirmation in the MEGA study.
20082208 2010 Advanced age, low left atrial appendage velocity, and factor V promoter sequence variation as predictors of left atrial thrombosis in patients with nonvalvular atrial fibrillation.
20079495 2010 Higher fibrinogen levels predict progression of coronary artery calcification in adults with type 1 diabetes.
20078877 2010 Gene polymorphisms in association with emerging cardiovascular risk markers in adult women.
20075509 2009 Clinical implications of adiponectin and inflammatory biomarkers in type 2 diabetes mellitus.
20064497 2010 Influence of Amerindian mitochondrial DNA haplogroups on thrombosis susceptibility and frequency of four genetic prothrombotic variants in Southern Chilean subjects.
20059469 2010 Interaction between fibrinogen and IL-6 genetic variants and associations with cardiovascular disease risk in the Cardiovascular Health Study.
20051843 2010 The effect of four hemostatic gene polymorphisms on the outcome of septic critically ill patients.
20036902 2010 Hemostatic gene polymorphisms in young Sardinian with non-fatal acute myocardial infarction.
20031577 2009 Novel loci, including those related to Crohn disease, psoriasis, and inflammation, identified in a genome-wide association study of fibrinogen in 17 686 women: the Women's Genome Health Study.
20031576 2009 Association of novel genetic Loci with circulating fibrinogen levels: a genome-wide association study in 6 population-based cohorts.
19996109 2010 Identification of human plasma proteins as major clients for the extracellular chaperone clusterin.
19956635 2009 Fulfilling the promise of personalized medicine? Systematic review and field synopsis of pharmacogenetic studies.
19954614 2009 [Relationship between multi-locus fibrinogen polymorphisms and fibrinogen concentration, molecular reactivity and cerebral infarction].
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19923980 2010 Impact of genetic polymorphisms on platelet function and aspirin resistance.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19906129 2010 A prospective case-control study analyzes 12 thrombophilic gene mutations in Turkish couples with recurrent pregnancy loss.
19899640 [Complex analysis of genetic predisposition to ischemic stroke in Russians].
19892918 2009 Genetic risk factors for periodontitis in a Japanese population.
19860767 2011 Genetic cardiovascular risk factors and age-related macular degeneration.
19811441 2009 The functional effects of the -455G/A polymorphism on the IL-6-induced expression of the beta-fibrinogen gene may be due to linkage disequilibrium with other functional polymorphisms.
19750100 2009 Modification of the interleukin-6 response to air pollution by interleukin-6 and fibrinogen polymorphisms.
19682239 2009 Replication of findings on the association of genetic variation in 24 hemostasis genes and risk of incident venous thrombosis.
19593947 2009 Association between -455G/A and fibrinogen in a Chinese population.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19560472 2009 Clinical factors such as B-type natriuretic peptide link to factor VII, endothelial NO synthase and estrogen receptor alpha polymorphism in elderly women.
19559392 2009 A candidate gene association study of 77 polymorphisms in migraine.
19508823 2009 Fibrinogen gene polymorphism (Bbeta-148C/T) in Uygur patients with cerebral infarction.
19479237 2009 Phenotype-genotype interactions on renal function in type 2 diabetes: an analysis using structural equation modelling.
19431272 2008 [The beta-fibrinogen gene polymorphism, fibrinogen level and platelet aggregation in patients with ischemic stroke].
19420351 2009 High prevalence of dysfibrinogenemia among patients with chronic thromboembolic pulmonary hypertension.
19420105 2009 A candidate gene approach to genetic prognostic factors of IgA nephropathy--a result of Polymorphism REsearch to DIstinguish genetic factors Contributing To progression of IgA Nephropathy (PREDICT-IgAN).
19409601 2010 G-455A polymorphism of beta-fibrinogen gene and the risk of premature myocardial infarction in Greece.
19404555 2009 Two novel mutations at contiguous codons in the fibrinogen Bbeta chain associated with hypofibrinogenaemia.
19395327 2009 Early pregnancy loss in celiac women: The role of genetic markers of thrombophilia.
19352213 2009 Antihypertensive pharmacogenetic effect of fibrinogen-beta variant -455G>A on cardiovascular disease, end-stage renal disease, and mortality: the GenHAT study.
19332210 2009 Candidate genetic variants in the fibrinogen, methylenetetrahydrofolate reductase, and intercellular adhesion molecule-1 genes and plasma levels of fibrinogen, homocysteine, and intercellular adhesion molecule-1 among various race/ethnic groups: data from the Women's Genome Health Study.
19296670 2009 Crystal structure of human fibrinogen.
19272152 2009 IL6 and CRP haplotypes are associated with COPD risk and systemic inflammation: a case-control study.
19264644 2009 ORF3 protein of hepatitis E virus interacts with the Bbeta chain of fibrinogen resulting in decreased fibrinogen secretion from HuH-7 cells.
19238444 2009 The genomic basis of cerebral palsy: a HuGE systematic literature review.
19229055 2009 Deletion of five residues from the coiled coil of fibrinogen (Bbeta Asn167_Glu171del) associated with bleeding and hypodysfibrinogenemia.
19227305 2008 [Genetic polymorphism and risk of arterial thrombosis in patients with atrial fibrillation].
19193866 2009 Fibrinogen-induced endothelin-1 production from endothelial cells.
19190816 2009 Association study between variants in the fibrinogen gene cluster, fibrinogen levels and hypertension: results from the MONICA/KORA study.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19143925 2009 Genetic variation in fibrinogen; its relationship to fibrinogen levels and the risk of myocardial infarction and ischemic stroke.
19136375 2009 Fibrinogen genes modify the fibrinogen response to ambient particulate matter.
19131662 2009 A meta-analysis of candidate gene polymorphisms and ischemic stroke in 6 study populations: association of lymphotoxin-alpha in nonhypertensive patients.
19072566 2008 Prevalence of prothrombotic polymorphisms in Greece.
19056482 2009 Association of a polymorphism of the apolipoprotein E gene with chronic kidney disease in Japanese individuals with metabolic syndrome.
18982866 2008 Influence of fibrinogen beta-chain gene variations on risk of myocardial infarction in a Chinese Han population.
18977990 2008 Candidate genes and cerebral palsy: a population-based study.
18974842 2008 Gender differences in genetic risk profiles for cardiovascular disease.
18936436 2009 Prevalence in the United States of selected candidate gene variants: Third National Health and Nutrition Examination Survey, 1991-1994.
18930220 2009 Thrombophilic gene polymorphisms are risk factors for unexplained infertility.
18927546 2008 Lp(a) and risk of recurrent cardiac events in obese postinfarction patients.
18853456 2009 A deep intronic mutation in FGB creates a consensus exonic splicing enhancer motif that results in afibrinogenemia caused by aberrant mRNA splicing, which can be corrected in vitro with antisense oligonucleotide treatment.
18848323 2009 Prothrombotic genetic variants and atherosclerosis in patients with cerebral ischemia of arterial origin.
18842294 2008 Association between the SERPING1 gene and age-related macular degeneration: a two-stage case-control study.
18841297 2008 Fibrinogen Foxton: a novel BbetaA277V mutation causing low normal plasma fibrinogen concentration.
18836720 2009 Prothrombotic polymorphisms, mutations, and their association with pediatric non-cardioembolic stroke in Asian-Indian patients.
18818200 2008 Fibrinogen beta-chain tyrosine nitration is a prothrombotic risk factor.
18803625 2008 Comparison of thrombophilic gene mutations among patients experiencing recurrent miscarriage and deep vein thrombosis.
18772067 2008 Common genetic polymorphisms and haplotypes of fibrinogen alpha, beta, and gamma chains affect fibrinogen levels and the response to proinflammatory stimulation in myocardial infarction survivors: the AIRGENE study.
18726528 2008 Association of beta-fibrinogen gene -148C/T and -455G/A polymorphisms and coronary artery disease in Chinese population: a meta analysis.
18685811 2009 Analysis of inherited thrombophilic mutations and natural anticoagulant deficiency in patients with idiopathic portal hypertension.
18683729 2008 [Correlation between levels of fibrinogen, beta455 g/A fibrinogen gene polymorphism and chronic periodontitis].
18676163 Congenital hypofibrinogenemia: characterization of two missense mutations affecting fibrinogen assembly and secretion.
18513389 2008 New application of intelligent agents in sporadic amyotrophic lateral sclerosis identifies unexpected specific genetic background.
18511872 2008 Meta-analysis of genetic studies from journals published in China of ischemic stroke in the Han Chinese population.
18503143 2008 Connection between genetically determined blood coagulation factors and haemorheology.
18434720 2008 Association of fibrinogen and fibrinogen gene beta148 and beta854 polymorphisms with coronary heart disease.
18334738 2008 Polymorphisms of the fibrinogen-beta gene are related to 2-hour glucose level after oral glucose tolerance test in Hong Kong Chinese.
18331453 2008 Fibrinogen gene variation and ischemic stroke.
18284606 2008 Polymorphisms in coagulation factors and the risk of recurrent cardiovascular events in men after a first myocardial infarction.
18278190 2008 Associations between common fibrinogen gene polymorphisms and cardiovascular disease in older adults. The Cardiovascular Health Study.
18253477 2008 Combined effect of hemostatic gene polymorphisms and the risk of myocardial infarction in patients with advanced coronary atherosclerosis.
18202324 2008 Fibrinogen genes and myocardial infarction: a haplotype analysis.
18188987 2007 A meta-analysis of beta-fibrinogen gene-455G/A polymorphism and plasma fibrinogen level in Chinese cerebral infarction patients.
18173921 Polymorphism of genes related to cardiovascular disease in patients with rheumatoid arthritis.
18057060 2008 Fibrinogen Aalpha Thr312Ala polymorphism is associated with chronic thromboembolic pulmonary hypertension.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18000621 2007 Fibrinogen Tolaga Bay: a novel gammaAla341Val mutation causing hypofibrinogenaemia.
17994314 2007 Haemostatic genetic variants, ABO blood group and bleeding risk during oral anticoagulant treatment after cerebral ischaemia of arterial origin.
17951283 2008 Haplotypes of the fibrinogen gene and cerebral small vessel disease: the Rotterdam scan study.
17925485 2008 Common variation in the C-terminal region of the fibrinogen beta-chain: effects on fibrin structure, fibrinolysis and clot rigidity.
17849064 2007 Clinical and biological features of 3 cases of hypofibrinogenemia associated with three different mutations (gamma Ala341Thr, Bbeta Tyr326Cys and Aalpha Asp496Asn).
17688324 2007 Probing the beta-chain hole of fibrinogen with synthetic peptides that differ at their amino termini.
17637253 2007 A meta-analysis of relationship between beta-fibrinogen gene -148C/T polymorphism and susceptibility to cerebral infarction in Han Chinese.
17591786 2007 The chymotrypsin-like protease complex of Treponema denticola ATCC 35405 mediates fibrinogen adherence and degradation.
17582472 2007 Associations of the beta-fibrinogen Hae III and factor XIII Val34Leu gene variants with venous thrombosis.
17497226 2008 Frequency distribution of the G/A alleles of the beta-fibrinogen gene in the Lebanese population.
17469143 2007 Epistatic effect of plasminogen activator inhibitor 1 and beta-fibrinogen genes on risk of glomerular microthrombosis in lupus nephritis: interaction with environmental/clinical factors.
17414213 2007 Fibrinogen and fibrin: scaffold proteins in hemostasis.
17264952 2007 Genetic variation in estrogen receptor, C-reactive protein and fibrinogen does not predict the plasma levels of inflammation markers after longterm hormone replacement therapy.
17263791 2007 Elevated plasma fibrinogen gamma' concentration is associated with myocardial infarction: effects of variation in fibrinogen genes and environmental factors.
17230042 2006 Mutations and polymorphisms in genes affecting haemostasis components in children with thromboembolic events.
17160939 2006 [Association of fibrinogen B beta -1420G/A, -993C/T and -854G/A gene polymorphism with coronary heart disease].
17126309 2007 AMI is associated with polymorphisms in the NOS3 and FGB but not in PAI-1 genes in young adults.
17116333 2007 Fibrinogen-beta gene haplotype is associated with mortality in sepsis.
17115186 2007 TagSNP evaluation for the association of 42 inflammation loci and vascular disease: evidence of IL6, FGB, ALOX5, NFKBIA, and IL4R loci effects.
17111197 2006 A comprehensive analysis of 12 thrombophilic mutations and related parameters in patients with inflammatory bowel disease: data from Turkey.
17003923 2006 Gene polymorphisms implicated in influencing susceptibility to venous and arterial thromboembolism: frequency distribution in a healthy German population.
16953282 2006 Fibrinogen Nottingham II: a novel Bbeta Arg264gly substitution causing hypofibrinogenaemia.
16940416 2007 Polymerization of fibrin: Direct observation and quantification of individual B:b knob-hole interactions.
16938111 2006 Which thrombophilic gene mutations are risk factors for recurrent pregnancy loss?
16928957 2006 Matrix-specific suppression of integrin activation in shear stress signaling.
16899909 2006 Contribution of the -455G/A polymorphism at beta-fibrinogen gene and of the Leiden mutation to hemorheological parameters in ischemic stroke patients.
16846481 2006 The fibrinogen Aalpha R16C mutation results in fibrinolytic resistance.
16776623 2006 Polymorphisms associated with apolipoprotein B levels in Greek patients with familial hypercholesterolemia.
16767673 2006 [A related analysis for alpha, beta fibrinogen gene haplotypes and nucleotide polymorphisms associated with the ischemic stroke in Hainan Han population].
16750002 2006 [Study on the relationship between polymorphisms of susceptible genes in coagulation pathway related to pulmonary thromboembolism in Chinese Han population].
16706972 2006 Association between patterns of nucleotide variation across the three fibrinogen genes and plasma fibrinogen levels: the Coronary Artery Risk Development in Young Adults (CARDIA) study.
16697386 2007 Analysis of the effect of multiple genetic variants of cardiovascular disease risk on insulin concentration variability in healthy adults of the STANISLAS cohort. The role of FGB-455 G/A polymorphism.
16635210 2006 Multiple thrombophilic gene mutations rather than specific gene mutations are risk factors for recurrent miscarriage.
16614319 2006 Common genetic variation in five thrombosis genes and relations to plasma hemostatic protein level and cardiovascular disease risk.
16611940 2006 Cryptic splice site usage in exon 7 of the human fibrinogen Bbeta-chain gene is regulated by a naturally silent SF2/ASF binding site within this exon.
16604498 2006 [A linkage between beta-fibrinogen gene -148C/T polymorphism and cerebral infarction].
16601848 2006 Hypofibrinogenaemia resulting from novel single nucleotide deletion at codon Bbeta58 (3404del A) associated with thrombotic stroke in infancy.
16581250 2006 p130Cas: a versatile scaffold in signaling networks.
16567932 2006 Mutations and polymorphisms in genes affecting hemostasis proteins and homocysteine metabolism in children with arterial ischemic stroke.
16525569 2006 Gender differences in the expression of erythrocyte aggregation in relation to B beta-fibrinogen gene polymorphisms in apparently healthy individuals.
16525568 2006 Epistatic and pleiotropic effects of polymorphisms in the fibrinogen and coagulation factor XIII genes on plasma fibrinogen concentration, fibrin gel structure and risk of myocardial infarction.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16489740 2006 Modification of fibrinogen by homocysteine thiolactone increases resistance to fibrinolysis: a potential mechanism of the thrombotic tendency in hyperhomocysteinemia.
16466010 2005 [Pharmacogenetics of the local thrombolysis in patients with deep vein thrombosis].
16443328 2006 Association studies of genetic polymorphism, environmental factors and their interaction in ischemic stroke.
16420563 2006 Multi-locus candidate gene polymorphisms and risk of myocardial infarction: a population-based, prospective genetic analysis.
16409729 2005 [The relationship between the five beta-fibrinogen gene polymorphisms and cerebral infarction].
16353042 2005 [Associations of hemostasis factors genes with early development of ischemic heart disease and manifestation of myocardial infarction in young age].
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16324093 2005 A role of TNF-alpha gene variant on juvenile ischemic stroke: a case-control study.
16263699 2006 Elucidation of N-glycosylation sites on human platelet proteins: a glycoproteomic approach.
16215953 2005 [Correlation between fibrinogen polymorphisms and the type of cerebral infarction].
16195396 2005 Quality control of fibrinogen secretion in the molecular pathogenesis of congenital afibrinogenemia.
16157382 2005 Role of thrombophilic gene polymorphisms in branch retinal vein occlusion.
16144795 2005 Genetic variation in the fibrinogen gamma gene increases the risk for deep venous thrombosis by reducing plasma fibrinogen gamma' levels.
16086292 2005 [Nine polymorphisms of fibrinogen gene and their association with plasma fibrinogen levels in Hainan Han population].
16080811 2005 [Association of matrix metalloproteinase-9 and platelet membrane glycoprotein VI polymorphisms with acute coronary syndrome].
16049588 Coagulation gene polymorphisms as risk factors for myocardial infarction in young Indian Asians.
16005629 2005 Integrins and Src: dynamic duo of adhesion signaling.
15983960 2005 Beta-fibrinogen haplotypes and the risk for cardiovascular disease in a dialysis cohort.
15968394 2005 Polymorphisms in prothrombotic genes and their impact on ischemic stroke in a Sardinian population.
15939070 2005 Common promoter polymorphisms of inflammation and thrombosis genes and longevity in older adults: the cardiovascular health study.
15857159 2006 Relationship among urinary albumin excretion rate, lipoprotein lipase PvuII polymorphism and plasma fibrinogen in type 2 diabetic patients.
15842357 2005 Liver histology of an afibrinogenemic patient with the Bbeta-L353R mutation showing no evidence of hepatic endoplasmic reticulum storage disease (ERSD); comparative study in COS-1 cells of the intracellular processing of the Bbeta-L353R fibrinogen vs. the ERSD-associated gamma-G284R mutant.
15795540 2005 gammaAla82Gly represents a common fibrinogen gamma-chain variant in Caucasians.
15795538 2005 No association between pulmonary embolism or deep vein thrombosis and the -455G/A beta-fibrinogen gene polymorphism.
15793786 2005 [Inherited dysfibrinogenemia caused by Arg275His in the beta chain of fibrinogen].
15739255 2005 Fibrinogen and fragment D-induced vascular constriction.
15737987 2005 A hepatocyte nuclear factor-3 site in the fibrinogen beta promoter is important for interleukin 6-induced expression, and its activity is influenced by the adjacent -148C/T polymorphism.
15735812 2005 Contribution of haplotypes across the fibrinogen gene cluster to variation in risk of myocardial infarction.
15735811 2005 -455G/A polymorphism and preprocedural plasma levels of fibrinogen show no association with the risk of clinical restenosis in patients with coronary stent placement.
15709716 2004 The -455G/A polymorphism of the beta fibrinogen gene and the Bgl II polymorphism of the alpha2beta1 integrin gene and myocardial infarction in patients with type 2 diabetes.
15671034 2005 Regulation of gamma-fibrinogen chain expression by heterogeneous nuclear ribonucleoprotein A1.
15631828 2004 [The relationship between beta fibrinogen gene-455G/A polymorphisms and Budd-Chiari syndrome].
15608011 2005 The -148 C/T fibrinogen gene polymorphism and fibrinogen levels in ischaemic stroke: a case-control study.
15583729 2004 Plasma fibrinogen concentration predicts the risk of myocardial infarction differently in various parts of Europe: effects of beta-fibrinogen genotype and environmental factors. The HIFMECH Study.
15575509 2004 [Association of polymorphic marker G(-455)A of gene FGB with coronary artery disease].
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15346842 2004 Association of genetic polymorphisms in the fibrinogen and platelet glycoprotein genes with unstable angina in Chinese patients.
15300640 2004 [Relationship between fibrinogen B beta gene FGB -455G/A polymorphism and atherosclerotic cerebral infarction].
15217804 2004 Genetic and environmental determinants of fibrin structure and function: relevance to clinical disease.
15213870 2004 Erythrocyte aggregation and -455G/A polymorphism of the beta-fibrinogen gene in survivors of acute myocardial infarction.
15192836 2004 [Association between the polymorphism of beta-fibrinogen gene -455G/A and ischemic stroke].
15170397 Fibrinogen polymorphisms TaqI, HaeIII and BclI are not associated with a higher risk of deep vein thrombosis.
15104216 2004 Beta-fibrinogen promoter -455 G/A (HaeIII) polymorphism prediction of plasma fibrinogen but not of ischemic cerebrovascular disease.
15091001 2004 -455G/A beta-fibrinogen gene polymorphism, factor V Leiden, prothrombin G20210A mutation and MTHFR C677T, and placental vascular complications.
15076187 2004 Genetic influences on blood pressure within the Stanislas Cohort.
15070683 2004 Missense or splicing mutation? The case of a fibrinogen Bbeta-chain mutation causing severe hypofibrinogenemia.
14963283 2004 Absence of association between polymorphisms in the hemostatic factor pathway genes and carotid intimal medial thickness: the Framingham Heart Study.
14746139 2003 Molecular variation at functional genes and the history of human populations--data on candidate genes for cardiovascular risk in the Mediterranean.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
14706682 2004 Genetic polymorphisms associated with thrombophilia and vascular disease in women with unexplained late intrauterine fetal death: a multicenter study.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14691567 2004 Fibrinogen C-terminal peptidic sequences (Haptides) modulate fibrin polymerization.
14669221 2003 [Preliminary study on single nucleotide polymorphisms and linkage disequilibrium in promoter region of fibrinogen B beta gene].
14652632 2003 Fibrinogen B beta polymorphisms do not directly contribute to an altered in vitro clot structure in humans.
14629469 2003 Hypofibrinogenemia caused by a nonsense mutation in the fibrinogen Bbeta chain gene.
14629463 2003 The beta fibrinogen gene G-455-A polymorphism is a risk factor for Legg-Perthes disease.
14618197 2003 Myocardial infarction in patients aged less than 40 years. Frequency of BclI polymorphism in the fibrinogen beta-chain gene and plasma fibrinogen.
12899665 2004 Candidate genetic markers and the risk of restenosis after coronary angioplasty.
12893758 2003 Congenital afibrinogenemia: identification and expression of a missense mutation in FGB impairing fibrinogen secretion.
12878203 2003 Characterization of the enzymatic activity of human kallikrein 6: Autoactivation, substrate specificity, and regulation by inhibitors.
12871600 2003 Genetic risk factors for cerebrovascular disease in children with sickle cell disease: design of a case-control association study and genomewide screen.
12747593 2003 Genetic variations observed in arterial and venous thromboembolism--relevance for therapy, risk prevention and prognosis.
12716802 2003 Fibrinogen is a marker for nephropathy and peripheral vascular disease in type 1 diabetes: studies of plasma fibrinogen and fibrinogen gene polymorphism in the DCCT/EDIC cohort.
12710752 2003 Association of increased levels of fibrinogen and the -455G/A fibrinogen gene polymorphism with chronic periodontitis.
12706644 2003 Fibrinogen Magdeburg I: a novel variant of human fibrinogen with an amino acid exchange in the fibrinopeptide A (Aalpha 9, Leu-->Pro).
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12637691 2003 Fibrinogen gene promoter -455 A allele as a risk factor for lacunar stroke.
12624729 2003 Identification of a novel human angiopoietin-like gene expressed mainly in heart.
12617173 2002 New insights into fibrin (ogen) structure and function.
12616980 2002 Genetic polymorphisms modify the response of factor VII to oral contraceptive use: an example of gene-environment interaction.
12615788 2003 No evidence of association between prothrombotic gene polymorphisms and the development of acute myocardial infarction at a young age.
12578626 2001 [Effect of beta-Fibrinogen-455 Gene Polymorphism on Plasma Fibrinogen Levels in Patients with Ischemic Stroke]
12518110 2002 Spectrum and prevalence of prothrombotic single nucleotide polymorphism profiles in the Greek Cypriot population.
12514663 2003 Potential thrombophilic mutations/polymorphisms in patients with no flow-limiting stenosis after myocardial infarction.
12511408 2003 Prenatal diagnosis for congenital afibrinogenemia caused by a novel nonsense mutation in the FGB gene in a Palestinian family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12406024 2002 G-455A polymorphism of the fibrinogen beta gene and deep vein thrombosis.
12393540 2002 Congenital afibrinogenemia: first identification of splicing mutations in the fibrinogen Bbeta-chain gene causing activation of cryptic splice sites.
12356313 2002 2.8 A crystal structures of recombinant fibrinogen fragment D with and without two peptide ligands: GHRP binding to the "b" site disrupts its nearby calcium-binding site.
12161363 2002 Analysis of Iranian patients allowed the identification of the first truncating mutation in the fibrinogen Bbeta-chain gene causing afibrinogenemia.
12151156 2002 Fibrinogen and factor VII promoter polymorphisms in women with preeclampsia.
12141403 2002 Association of beta-fibrinogen and factor VII polymorphism with plasma fibrinogen and factor VII levels, and no association of PAI-1 polymorphism with plasma PAI-1 levels in hemodialysis patients.
12122980 2002 [Genetics of blood coagulation in young stroke patients].
12082592 2002 Multi-locus interactions predict risk for post-PTCA restenosis: an approach to the genetic analysis of common complex disease.
12082590 2002 The contribution of genetic factors to thrombotic and bleeding outcomes in coronary patients randomised to IIb/IIIa antagonists.
12048138 2002 Genetic determinants of the response to bezafibrate treatment in the lower extremity arterial disease event reduction (LEADER) trial.
11940334 2002 beta-fibrinogen gene -455A/G polymorphism and plasma fibrinogen level in Chinese stroke patients.
11877019 2000 [The study of beta-fibrinogen gene - 455 G/A, - 148 C/T, 448 G/A polymorphisms and their association with plasma fibrinogen levels].
11858186 2002 The effect of fibrinogen genotype on fibrinogen levels after strenuous physical exercise.
11836675 2002 [Genetic variations in plasminogen activator inhibitor-1 gene and beta fibrinogen gene associated with glomerular microthrombosis in lupus nephritis and the gene dosage effect].
11833854 2001 Variation of plasma D-dimer following surgery: implications for prediction of postoperative venous thromboembolism.
11798781 2000 [beta-fibrinogen gene -455A/G polymorphism and plasma fibrinogen level in Chinese stroke patients].
11728146 2001 Mutation in the promoter region of the beta-fibrinogen gene and the risk of future myocardial infarction, stroke and venous thrombosis.
11714857 2001 Genetic influences on lipid metabolism trait variability within the Stanislas Cohort.
11588042 2001 The alternatively spliced alpha(E)C domain of human fibrinogen-420 is a novel ligand for leukocyte integrins alpha(M)beta(2) and alpha(X)beta(2).
11546832 2001 Fibrinogen genotypes (alpha and beta) are associated with plasma fibrinogen levels in Chinese.
11468164 2001 The impaired polymerization of fibrinogen Longmont (Bbeta166Arg-->Cys) is not improved by removal of disulfide-linked dimers from a mixture of dimers and cysteine-linked monomers.
11460528 2001 Molecular mechanisms of hypo- and afibrinogenemia.
11460506 2001 Fibrinogen biosynthesis. Assembly, intracellular degradation, and association with lipid synthesis and secretion.
11296154 2001 Ethnic differences in fibrinogen levels: the role of environmental factors and the beta-fibrinogen gene.
11293402 2001 Beta-fibrinogen gene -455G/A polymorphism and coronary heart disease incidence: the Atherosclerosis Risk in Communities (ARIC) Study.
11054085 2000 Fibrinogen polymorphisms are not associated with the risk of myocardial infarction.
11027931 2000 Venous thrombosis in relation to fibrinogen and factor VII genes among African-Americans.
10980194 2000 Mapping of a minimal apolipoprotein(a) interaction motif conserved in fibrin(ogen) beta - and gamma -chains.
10903502 2000 Fibrinogen interactions with ICAM-1 (CD54) regulate endothelial cell survival.
10766195 2000 Fibrinogen assembly, secretion, and deposition into extracellular matrix by MCF-7 human breast carcinoma cells.
10666208 2000 Missense mutations in the human beta fibrinogen gene cause congenital afibrinogenemia by impairing fibrinogen secretion.
10605720 1999 Signaling through platelet integrin alpha IIb beta 3: inside-out, outside-in, and sideways.
10467729 1999 Fibrinogen.
10391209 1999 Characterization of single-nucleotide polymorphisms in coding regions of human genes.
10074346 1999 Conformational changes in fragments D and double-D from human fibrin(ogen) upon binding the peptide ligand Gly-His-Arg-Pro-amide.
9787167 1998 Formation of the human fibrinogen subclass fib420: disulfide bonds and glycosylation in its unique (alphaE chain) domains.
9628725 1998 Crystal structure of fragment double-D from human fibrin with two different bound ligands.
9351824 1997 Regulation of the pp72syk protein tyrosine kinase by platelet integrin alpha IIb beta 3.
9333233 1997 Crystal structures of fragment D from human fibrinogen and its crosslinked counterpart from fibrin.
9224210 1997 Polarized secretion of fibrinogen by lung epithelial cells.
9182580 1997 A mitogenic action for fibrinogen mediated through intercellular adhesion molecule-1.
9028318 1997 Induction of fibrinogen biosynthesis and secretion from cultured pulmonary epithelial cells.
8979138 1996 Regulation of fibrinogen biosynthesis by cytokines, consequences on the vascular risk.
8910396 1996 The role of betagamma and alphagamma complexes in the assembly of human fibrinogen.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
8666148 1996 Glucose-dependent interleukin 6 and tumor necrosis factor production by human peripheral blood monocytes in vitro.
8384496 1993 Binding of urinary protein C inhibitor to fibrin(ogen) and its binding mechanism.
8148485 1993 Urinary protein C inhibitor binding region in the B beta-chain of human fibrinogen.
8100742 1993 Fibrinogen mediates leukocyte adhesion to vascular endothelium through an ICAM-1-dependent pathway.
7642629 1995 The interaction of fibulin-1 with fibrinogen. A potential role in hemostasis and thrombosis.
7592883 1995 The mitogenic effects of the B beta chain of fibrinogen are mediated through cell surface calreticulin.
7583541 1995 Retinoids stimulate fibrinogen production both in vitro (hepatocytes) and in vivo. Induction requires activation of the retinoid X receptor.
7356959 1980 Studies on synthetic peptides that bind to fibrinogen and prevent fibrin polymerization. Structural requirements, number of binding sites, and species differences.
6777381 1980 Ca2+-mediated association of glycoprotein G (thrombinsensitive protein, thrombospondin) with human platelets.
6688356 1983 Characterization of complementary deoxyribonucleic acid and genomic deoxyribonucleic acid for the beta chain of human fibrinogen.
6575700 1983 Cloning of fibrinogen genes and their cDNA.
6575689 1983 Covalent structure of fibrinogen.
6575389 1983 Partial mRNA sequences for human A alpha, B beta, and gamma fibrinogen chains: evolutionary and functional implications.
6383194 1984 Fibrinogen and fibrin.
6281794 1982 gamma and alpha chains of human fibrinogen possess sites reactive with human platelet receptors.
6165239 1980 Fibrinogen Houston: a dysfibrinogen exhibiting defective fibrin monomer aggregation and alpha-chain cross-linkages.
5084810 1972 Quantitative studies on the release of platelet fibrinogen by thrombin.
3194892 1988 A polymorphism at B beta 448 of fibrinogen identified during structural studies of fibrinogen Baltimore II.
3156856 1985 Characterization of fibrinogen New York 1. A dysfunctional fibrinogen with a deletion of B beta(9-72) corresponding exactly to exon 2 of the gene.
3029722 1987 Characterization of the 5'-flanking region for the human fibrinogen beta gene.
2742826 1989 High-resolution NMR studies of fibrinogen-like peptides in solution: interaction of thrombin with residues 1-23 of the A alpha chain of human fibrinogen.
2572363 1989 DNA polymorphisms at fibrinogen loci and plasma fibrinogen concentration.
2322576 1990 Intracellular fate of fibrinogen B beta chain expressed in COS cells.
2143188 1990 A unique proteolytic fragment of human fibrinogen containing the A alpha COOH-terminal domain of the native molecule.
2102623 1990 Nucleotide sequences of the three genes coding for human fibrinogen.
2018836 1991 A new congenital abnormal fibrinogen Ise characterized by the replacement of B beta glycine-15 by cysteine.
1680863 1991 Potential role of entactin in hemostasis. Specific interaction of entactin with fibrinogen A alpha and B beta chains.
1634610 1992 Molecular basis of fibrinogen Naples associated with defective thrombin binding and thrombophilia. Homozygous substitution of B beta 68 Ala----Thr.
1565641 1992 Abnormal fibrinogens IJmuiden (B beta Arg14----Cys) and Nijmegen (B beta Arg44----Cys) form disulfide-linked fibrinogen-albumin complexes.
936108 1976 Disulfide bridges in nh2 -terminal part of human fibrinogen.
891553 1977 Primary structure of human fibrinogen. Characterization of disulfide-containing cyanogen-bromide fragments.
420779 1979 Amino acid sequence of the beta chain of human fibrinogen.
156564 1979 [Temperature-dependent changes in the profile of the sarcoplasmic reticulum membrane hydrophobic zones].