Property Summary

NCBI Gene PubMed Count 323
PubMed Score 753.08
PubTator Score 542.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (9)

Disease Target Count Z-score Confidence
Breast cancer 3578 0.0 0.5
Carcinoma 11493 0.0 1.3
Kidney cancer 2613 0.0 0.8
Disease Target Count Z-score Confidence
Atherosclerosis 291 0.0 3.0
Disease Target Count Z-score Confidence
Congenital afibrinogenemia 11 6.62 3.3
Disease Target Count Z-score Confidence
Amyloidosis 67 0.0 4.0
Disease Target Count Z-score Confidence
Schizophrenia 1160 4.948 2.5
Oculogyric crisis 4 3.223 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... -1.100 3.9e-02
lung adenocarcinoma 1.300 4.3e-02
lung cancer -1.400 4.1e-03
osteosarcoma 1.017 3.5e-04
ovarian cancer 1.100 1.3e-06

PDB (39)

Gene RIF (215)

AA Sequence

MFSMRIVCLVLSVVGTAWTADSGEGDFLAEGGGVRGPRVVERHQSACKDSDWPFCSDEDWNYKCPSGCRM      1 - 70
KGLIDEVNQDFTNRINKLKNSLFEYQKNNKDSHSLTTNIMEILRGDFSSANNRDNTYNRVSEDLRSRIEV     71 - 140
LKRKVIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAK    141 - 210
DLLPSRDRQHLPLIKMKPVPDLVPGNFKSQLQKVPPEWKALTDMPQMRMELERPGGNEITRGGSTSYGTG    211 - 280
SETESPRNPSSAGSWNSGSSGPGSTGNRNPGSSGTGGTATWKPGSSGPGSTGSWNSGSSGTGSTGNQNPG    281 - 350
SPRPGSTGTWNPGSSERGSAGHWTSESSVSGSTGQWHSESGSFRPDSPGSGNARPNNPDWGTFEEVSGNV    351 - 420
SPGTRREYHTEKLVTSKGDKELRTGKEKVTSGSTTTTRRSCSKTVTKTVIGPDGHKEVTKEVVTSEDGSD    421 - 490
CPEAMDLGTLSGIGTLDGFRHRHPDEAAFFDTASTGKTFPGFFSPMLGEFVSETESRGSESGIFTNTKES    491 - 560
SSHHPGIAEFPSRGKSSSYSKQFTSSTSYNRGDSTFESKSYKMADEAGSEADHEGTHSTKRGHAKSRPVR    561 - 630
DCDDVLQTHPSGTQSGIFNIKLPGSSKIFSVYCDQETSLGGWLLIQQRMDGSLNFNRTWQDYKRGFGSLN    631 - 700
DEGEGEFWLGNDYLHLLTQRGSVLRVELEDWAGNEAYAEYHFRVGSEAEGYALQVSSYEGTAGDALIEGS    701 - 770
VEEGAEYTSHNNMQFSTFDRDADQWEENCAEVYGGGWWYNNCQAANLNGIYYPGGSYDPRNNSPYEIENG    771 - 840
VVWVSFRGADYSLRAVRMKIRPLVTQ                                                841 - 866
//

Text Mined References (335)

PMID Year Title