Property Summary

Ligand Count 10
NCBI Gene PubMed Count 48
PubMed Score 163.84
PubTator Score 77.36

Knowledge Summary

Patent (10,097)

Expression

  Differential Expression (8)

Disease log2 FC p
active Crohn's disease 1.416 3.7e-02
atypical teratoid / rhabdoid tumor -1.300 9.3e-06
intraductal papillary-mucinous carcinoma... 1.400 2.0e-02
lung carcinoma -2.000 7.4e-13
medulloblastoma -1.200 3.9e-05
medulloblastoma, large-cell -1.200 9.5e-03
non-small cell lung carcinoma -1.200 4.3e-15
pituitary cancer -1.700 1.5e-03

 GWAS Trait (1)

Gene RIF (38)

AA Sequence

MSPECARAAGDAPLRSLEQANRTRFPFFSDVKGDHRLVLAAVETTVLVLIFAVSLLGNVCALVLVARRRR      1 - 70
RGATACLVLNLFCADLLFISAIPLVLAVRWTEAWLLGPVACHLLFYVMTLSGSVTILTLAAVSLERMVCI     71 - 140
VHLQRGVRGPGRRARAVLLALIWGYSAVAALPLCVFFRVVPQRLPGADQEISICTLIWPTIPGEISWDVS    141 - 210
FVTLNFLVPGLVIVISYSKILQTSEHLLDARAVVTHSEITKASRKRLTVSLAYSESHQIRVSQQDFRLFR    211 - 280
TLFLLMVSFFIMWSPIIITILLILIQNFKQDLVIWPSLFFWVVAFTFANSALNPILYNMTLCRNEWKKIF    281 - 350
CCFWFPEKGAILTDTSVKRNDLSIISG                                               351 - 377
//

Text Mined References (50)

PMID Year Title