Property Summary

NCBI Gene PubMed Count 41
PubMed Score 135.13
PubTator Score 77.36

Knowledge Summary

Patent (10,097)

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 9.3e-06
medulloblastoma -1.200 3.9e-05
medulloblastoma, large-cell -1.200 9.5e-03
intraductal papillary-mucinous carcinoma... 1.400 2.0e-02
active Crohn's disease 1.416 3.7e-02
lung carcinoma -2.000 7.4e-13
non-small cell lung carcinoma -1.200 4.3e-15
pituitary cancer -1.700 1.5e-03

 GWAS Trait (1)

Gene RIF (31)

PMID Text
26968637 GPR120 negatively and GPR40 positively regulate cellular functions during tumor progression in lung cancer cells.
26791484 demonstrated a GPR120-mediated novel anti-inflammatory pathway in specific intestinal epithelial cell types that could be of therapeutic relevance to intestinal inflammatory disorders
26282200 These results suggest that distinct effects of GPR120 and GPR40 are involved in the acquisition of malignant property in pancreatic cancer cells.
26230883 GPR120 functions as a receptor for omega-3 fatty acid, involving in regulating the secretion of gastrointestinal peptide hormone, adipogenesis, adipogenic differentiation and anti-inflammatory process. [review]
26028412 It promotes the secretion of glucagon-like peptide-1 (GLP-1) in the intestine, and also acts as a lipid sensor in adipose tissue to sense dietary fat and control energy balance.(review)
26025001 the low-frequency p.R270H variant which inhibits GPR120 activity might influence fasting glucose levels in a normal physiological range.
25790291 Findings demonstrate the novel functional properties of GPR120 on human eosinophils and indicate the previously unrecognized link between nutrient metabolism and the immune system.
25447053 TNFa decreases GLP-2 expression by up-regulating GPR120 in Crohn disease
25250621 a significant interaction effect on alanine transaminase levels suggesting a driving effect of the PNPLA3 148M allele on liver injury in children with obesity carrying this variant.
25131623 Characterizing pharmacological ligands to study the long-chain fatty acid receptors GPR40/FFA1 and GPR120/FFA4
25114508 GPR120 may have a positive role in the management of diabetes;GPR120 activation supports metabolic homeostasis by inhibiting inflammation in macrophages and regulating glucose and/or lipid metabolism in adipose, liver, and muscle tissues
24913719 Morbidly obese subjects had lower GPR120 mRNA and protein levels in visceral adipose tissue and a lower mRNA expression after a high-fat meal in peripheral blood mononuclear cells.
24876224 Authors show that oleic acid stimulates lipid droplet formation by activating the long-chain fatty acid receptor FFAR4, which signals through a pertussis-toxin-sensitive G-protein signalling pathway involving PI3-kinase, AKT and (PLD) activities.
24860101 detailed mode of binding of both long-chain fatty acid and synthetic agonist ligands at FFA4 by integrating molecular modeling, receptor mutagenesis, and ligand structure-activity relationship approaches in an iterative format
24844436 GPR120 is predominantly expressed in the microvillous membrane (MVM) of placenta and the expression level of this receptor in MVM is not altered by maternal body mass index
24817122 Phosphorylation and structural elements within the C-terminal tail of FFA4 allow for the recruitment of arrestin-3.
24790272 G protein-coupled receptor 120 (GPR 120) levels are reduced in pediatric obstructive sleep apnea and obesity (particularly when both are present) and may play a role in modulating the degree of insulin resistance
24742677 GPR120 is a nutrient sensor that is activated endogenously by both saturated and unsaturated long chain fatty acids.
24412488 CD36 and GPR120 have nonoverlapping roles in taste bud cell signaling during orogustatory perception of dietary lipids; these are differentially regulated by obesity.
24412271 Basal and heterologous phosphorylation of FFA4 is mediated by protein kinase C.
24239485 Free fatty acids and protein kinase C activation induce GPR120 phosphorylation.
23993698 this study demonstrates the expression of GPR120 in pancreas and shows the distribution of GPR120 in human and rat pancreas.
23851494 these results demonstrate that GPR120 functions as a tumor-promoting receptor in colorectal carcinoma and, therefore, shows promise as a new potential target for cancer therapeutics.
23849180 Our results show that EPA, DHA and AA elicit the same signalling events, but with different kinetics and efficiency through GPR120 in Caco-2 cells.
23594480 Our data suggest that the combination of common genetic variations in the GPR120 gene and dietary fat intake is a possible determinant of body mass index.
22343897 GPR120 expression in adipose tissue is significantly higher in obese individuals than in lean controls; GPR120 exon sequencing in obese subjects reveals a deleterious non-synonymous mutation (p.R270H) that inhibits GPR120 signalling activity
22282525 agonist-stimulated GPR120S and GPR120L receptors both recruited beta-arrestin2 and underwent robust internalization.
21868624 GPR120 may participate in human gustatory fatty acid perception.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20471368 These are the first results which demonstrate specific phosphorylation of GPR120 isoforms upon agonism by free fatty acids and the first which distinguish the phosphorylation profiles of the two GPR120 isoforms.
19723586 possible significance of the alternate splice variant of GPR120 in human is discussed

AA Sequence

MSPECARAAGDAPLRSLEQANRTRFPFFSDVKGDHRLVLAAVETTVLVLIFAVSLLGNVCALVLVARRRR      1 - 70
RGATACLVLNLFCADLLFISAIPLVLAVRWTEAWLLGPVACHLLFYVMTLSGSVTILTLAAVSLERMVCI     71 - 140
VHLQRGVRGPGRRARAVLLALIWGYSAVAALPLCVFFRVVPQRLPGADQEISICTLIWPTIPGEISWDVS    141 - 210
FVTLNFLVPGLVIVISYSKILQTSEHLLDARAVVTHSEITKASRKRLTVSLAYSESHQIRVSQQDFRLFR    211 - 280
TLFLLMVSFFIMWSPIIITILLILIQNFKQDLVIWPSLFFWVVAFTFANSALNPILYNMTLCRNEWKKIF    281 - 350
CCFWFPEKGAILTDTSVKRNDLSIISG                                               351 - 377
//

Text Mined References (43)

PMID Year Title
26968637 2016 Diverse effects of G-protein-coupled free fatty acid receptors on the regulation of cellular functions in lung cancer cells.
26791484 2016 A novel anti-inflammatory role of GPR120 in intestinal epithelial cells.
26282200 2015 Different roles of GPR120 and GPR40 in the acquisition of malignant properties in pancreatic cancer cells.
26230883 2015 Biological characteristics and agonists of GPR120 (FFAR4) receptor: the present status of research.
26028412 2015 [Free Fatty Acid Receptor Family: A New Therapeutic Target for Metabolic Diseases].
26025001 2015 Contribution of the low-frequency, loss-of-function p.R270H mutation in FFAR4 (GPR120) to increased fasting plasma glucose levels.
25790291 2015 Functional analysis of free fatty acid receptor GPR120 in human eosinophils: implications in metabolic homeostasis.
25447053 2015 Tumor necrosis factor ? decreases glucagon-like peptide-2 expression by up-regulating G-protein-coupled receptor 120 in Crohn disease.
25250621 2014 Novel association between a nonsynonymous variant (R270H) of the G-protein-coupled receptor 120 and liver injury in children and adolescents with obesity.
25131623 2015 Characterizing pharmacological ligands to study the long-chain fatty acid receptors GPR40/FFA1 and GPR120/FFA4.
25114508 2014 Potential roles of GPR120 and its agonists in the management of diabetes.
24913719 2014 Effects of obesity/fatty acids on the expression of GPR120.
24876224 2014 Lipid droplet formation in response to oleic acid in Huh-7 cells is mediated by the fatty acid receptor FFAR4.
24860101 2014 The molecular basis of ligand interaction at free fatty acid receptor 4 (FFA4/GPR120).
24844436 2014 Expression and localization of the omega-3 fatty acid receptor GPR120 in human term placenta.
24817122 2014 Concomitant action of structural elements and receptor phosphorylation determines arrestin-3 interaction with the free fatty acid receptor FFA4.
24790272 2014 Obstructive sleep apnea and obesity are associated with reduced GPR 120 plasma levels in children.
24742677 2014 Alteration of the glucagon axis in GPR120 (FFAR4) knockout mice: a role for GPR120 in glucagon secretion.
24412488 2014 CD36- and GPR120-mediated Ca²? signaling in human taste bud cells mediates differential responses to fatty acids and is altered in obese mice.
24412271 2014 Mechanisms of homologous and heterologous phosphorylation of FFA receptor 4 (GPR120): GRK6 and PKC mediate phosphorylation of Thr³??, Ser³??, and Ser³?? in the C-terminal tail.
24239485 2014 Free fatty acids and protein kinase C activation induce GPR120 (free fatty acid receptor 4) phosphorylation.
23993698 2013 Phenotypic characterization of GPR120-expressing cells in the interstitial tissue of pancreas.
23851494 2013 Identification of G-protein-coupled receptor 120 as a tumor-promoting receptor that induces angiogenesis and migration in human colorectal carcinoma.
23849180 2013 Omega-3 and omega-6 PUFAs induce the same GPR120-mediated signalling events, but with different kinetics and intensity in Caco-2 cells.
23594480 2013 The combined effects of genetic variations in the GPR120 gene and dietary fat intake on obesity risk.
22343897 2012 Dysfunction of lipid sensor GPR120 leads to obesity in both mouse and human.
22282525 2012 Differential signaling by splice variants of the human free fatty acid receptor GPR120.
21878437 2011 Genome-wide association study of circulating retinol levels.
21868624 2012 G protein-coupled receptors in human fat taste perception.
20813258 2010 GPR120 is an omega-3 fatty acid receptor mediating potent anti-inflammatory and insulin-sensitizing effects.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20471368 2010 Agonism with the omega-3 fatty acids alpha-linolenic acid and docosahexaenoic acid mediates phosphorylation of both the short and long isoforms of the human GPR120 receptor.
19723586 2009 Cloning, expression, and pharmacological characterization of the GPR120 free fatty acid receptor from cynomolgus monkey: comparison with human GPR120 splice variants.
19460454 2009 Free fatty acid receptors act as nutrient sensors to regulate energy homeostasis.
17250804 2007 The regulation of adipogenesis through GPR120.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15619630 2005 Free fatty acids regulate gut incretin glucagon-like peptide-1 secretion through GPR120.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14623098 2003 Seven evolutionarily conserved human rhodopsin G protein-coupled receptors lacking close relatives.
12679517 2003 The G protein-coupled receptor repertoires of human and mouse.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.