Property Summary

Ligand Count 6
NCBI Gene PubMed Count 42
PubMed Score 144.58
PubTator Score 60.47

Knowledge Summary

Patent (9,122)

TINX Plot

  Disease (3)

Expression

  Differential Expression (5)

Disease log2 FC p
interstitial cystitis 1.200 8.0e-03
Multiple Sclerosis 1.200 2.5e-02
psoriasis 1.400 5.5e-46
Rheumatoid arthritis 1.100 4.5e-02
ulcerative colitis 2.000 2.2e-03

Gene RIF (29)

AA Sequence

MLPDWKSSLILMAYIIIFLTGLPANLLALRAFVGRIRQPQPAPVHILLLSLTLADLLLLLLLPFKIIEAA      1 - 70
SNFRWYLPKVVCALTSFGFYSSIYCSTWLLAGISIERYLGVAFPVQYKLSRRPLYGVIAALVAWVMSFGH     71 - 140
CTIVIIVQYLNTTEQVRSGNEITCYENFTDNQLDVVLPVRLELCLVLFFIPMAVTIFCYWRFVWIMLSQP    141 - 210
LVGAQRRRRAVGLAVVTLLNFLVCFGPYNVSHLVGYHQRKSPWWRSIAVVFSSLNASLDPLLFYFSSSVV    211 - 280
RRAFGRGLQVLRNQGSSLLGRRGKDTAEGTNEDRGVGQGEGMPSSDFTTE                        281 - 330
//

Text Mined References (42)

PMID Year Title