Property Summary

Ligand Count 241
NCBI Gene PubMed Count 60
PubMed Score 296.22
PubTator Score 154.61

Knowledge Summary

Patent (29,866)

Expression

Gene RIF (51)

AA Sequence

MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASG      1 - 70
AWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGL     71 - 140
VFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALA    141 - 210
RSGLTHRRKLRAAWVAGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLG    211 - 280
RGPGLKTVCAARTQGGKSQK                                                      281 - 300
//

Text Mined References (60)

PMID Year Title