Property Summary

NCBI Gene PubMed Count 13
PubMed Score 117.90
PubTator Score 915.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.700 3.9e-02
astrocytic glioma -1.900 1.2e-03
Astrocytoma, Pilocytic -2.600 2.2e-04
atypical teratoid / rhabdoid tumor -2.300 8.3e-04
ependymoma -2.200 1.8e-03
glioblastoma -2.100 1.1e-04
group 3 medulloblastoma 2.800 4.1e-02
oligodendroglioma -2.000 2.2e-03
primitive neuroectodermal tumor -2.800 4.2e-03
psoriasis -1.700 1.4e-03
severe Alzheimer's disease -1.114 5.0e-02

Gene RIF (7)

AA Sequence

MASSASLETMVPPACPRAGASPATSKTLAFSIERIMAKTSEPRAPFEPRPGALEADGSQGKKLLNLCSPL      1 - 70
PCMIPLQPLGYEVPSKTLLSYSELWKSSLRAGGGGGGGGGGGGGGGGAPVCGASGLCKTNCGVCCKAELG     71 - 140
LAPSALPAGRVIKPQVINQAVGLPASGSLYYFNYLDSTAYPPSELLSGHLFPSGLLNAQAPAALAAHPKL    141 - 210
FLLENAKLAGLAADKFPHPAPYPHKERLPAPLEQVLKENSALTAERGGVKGHSKLPGGSADGKPKNFTCE    211 - 280
VCGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTQEKPHKCNQCGKAFNRSSTLNT    281 - 350
HIRIHAGYKPFVCEFCGKGFHQKGNYKNHKLTHSGEKQYKCTICNKAFHQVYNLTFHMHTHNDKKPFTCA    351 - 420
TCGKGFCRNFDLKKHVRKLHDSVGPAAPSAKDLTRTVQS                                   421 - 459
//

Text Mined References (15)

PMID Year Title