Property Summary

NCBI Gene PubMed Count 15
PubMed Score 1.27
PubTator Score 1.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma -1.500 8.4e-07
osteosarcoma -2.803 2.2e-11
group 4 medulloblastoma -2.700 6.0e-08
astrocytoma 1.100 2.0e-02
medulloblastoma, large-cell -1.400 2.4e-04
fascioscapulohumeral muscular dystrophy 1.488 5.3e-06
primary pancreatic ductal adenocarcinoma 1.092 4.8e-02
intraductal papillary-mucinous adenoma (... 1.400 1.1e-02
lung cancer -1.400 2.7e-03
lung carcinoma -1.100 1.4e-20
invasive ductal carcinoma -1.100 8.1e-03
ovarian cancer -3.100 1.3e-11
dermatomyositis 1.500 1.7e-03

Gene RIF (4)

PMID Text
21408165 FEZ2 interacted with 59 proteins and that of these only 40 interacted with FEZ1.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
16484223 the C-terminal regions of FEZ1, and especially its coiled-coil region, are involved in its dimerization, its heterodimerization with FEZ2, and in the interaction with 10 of the identified interacting proteins

AA Sequence

MAADGDWQDFYEFQEPARSLLDQENCNASPEPGAEAGAEAGGGADGFPAPACSLEEKLSLCFRPSDPGAE      1 - 70
PPRTAVRPITERSLLQGDEIWNALTDNYGNVMPVDWKSSHTRTLHLLTLNLSEKGVSDSLLFDTSDDEEL     71 - 140
REQLDMHSIIVSCVNDEPLFTADQVIEEIEEMMQESPDPEDDETPTQSDRLSMLSQEIQTLKRSSTGSYE    141 - 210
ERVKRLSVSELNEILEEIETAIKEYSEELVQQLALRDELEFEKEVKNSFISVLIEVQNKQKEHKETAKKK    211 - 280
KKLKNGSSQNGKNERSHMPGTYLTTVIPYEKKNGPPSVEDLQILTKILRAMKEDSEKVPSLLTDYILKVL    281 - 350
CPT                                                                       351 - 353
//

Text Mined References (19)

PMID Year Title
25495476 2014 RAB3GAP1 and RAB3GAP2 modulate basal and rapamycin-induced autophagy.
24705354 2014 The palmitoyl acyltransferase HIP14 shares a high proportion of interactors with huntingtin: implications for a role in the pathogenesis of Huntington's disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21408165 2011 FEZ2 has acquired additional protein interaction partners relative to FEZ1: functional and evolutionary implications.
20812761 2010 Human FEZ1 protein forms a disulfide bond mediated dimer: implications for cargo transport.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
16484223 2006 FEZ1 dimerization and interaction with transcription regulatory proteins involves its coiled-coil region.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14697253 2004 Identification of a tissue-non-specific homologue of axonal fasciculation and elongation protein zeta-1.
14690447 2003 Identification of proteins that interact with the central coiled-coil region of the human protein kinase NEK1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.
10642437 2000 CRIM1, a novel gene encoding a cysteine-rich repeat protein, is developmentally regulated and implicated in vertebrate CNS development and organogenesis.
9096408 1997 The Caenorhabditis elegans gene unc-76 and its human homologs define a new gene family involved in axonal outgrowth and fasciculation.
8228263 1993 Identification of human pre-T/NK cell-associated genes.