Tbio | Fasciculation and elongation protein zeta-1 |
May be involved in axonal outgrowth as component of the network of molecules that regulate cellular morphology and axon guidance machinery. Able to restore partial locomotion and axonal fasciculation to C.elegans unc-76 mutants in germline transformation experiments. May participate in the transport of mitochondria and other cargos along microtubules.
This gene is an ortholog of the C. elegans unc-76 gene, which is necessary for normal axonal bundling and elongation within axon bundles. Expression of this gene in C. elegans unc-76 mutants can restore to the mutants partial locomotion and axonal fasciculation, suggesting that it also functions in axonal outgrowth. The N-terminal half of the gene product is highly acidic. Alternatively spliced transcript variants encoding different isoforms of this protein have been described. [provided by RefSeq, Jul 2008]
This gene is an ortholog of the C. elegans unc-76 gene, which is necessary for normal axonal bundling and elongation within axon bundles. Expression of this gene in C. elegans unc-76 mutants can restore to the mutants partial locomotion and axonal fasciculation, suggesting that it also functions in axonal outgrowth. The N-terminal half of the gene product is highly acidic. Alternatively spliced transcript variants encoding different isoforms of this protein have been described. [provided by RefSeq, Jul 2008]
Comments
Disease | Target Count |
---|---|
Psychotic Disorders | 151 |
Schizoaffective Disorder | 55 |
Disease | Target Count | P-value |
---|---|---|
lung adenocarcinoma | 2716 | 1.3e-14 |
Breast cancer | 3578 | 5.4e-14 |
lung carcinoma | 2843 | 2.0e-10 |
non-small cell lung cancer | 2890 | 6.1e-07 |
medulloblastoma, large-cell | 6241 | 1.6e-06 |
malignant mesothelioma | 3232 | 2.7e-06 |
lung cancer | 4740 | 2.9e-04 |
tuberculosis | 2010 | 4.4e-04 |
invasive ductal carcinoma | 2951 | 2.5e-03 |
atypical teratoid/rhabdoid tumor | 357 | 3.4e-03 |
colon cancer | 1478 | 3.4e-03 |
intraductal papillary-mucinous adenoma (IPMA) | 2955 | 3.5e-03 |
intraductal papillary-mucinous carcinoma (IPMC) | 2989 | 3.8e-03 |
subependymal giant cell astrocytoma | 2287 | 1.8e-02 |
intraductal papillary-mucinous neoplasm (IPMN) | 3291 | 1.8e-02 |
type I diabetes mellitus | 22 | 2.6e-02 |
ductal carcinoma in situ | 1745 | 2.9e-02 |
active ulcerative colitis | 764 | 3.8e-02 |
adrenocortical carcinoma | 1428 | 3.9e-02 |
active Crohn's disease | 922 | 4.2e-02 |
group 3 medulloblastoma | 4104 | 4.3e-02 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Schizophrenia | 1160 | 3.877 | 1.9 |
Bipolar Disorder | 666 | 0.0 | 1.9 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Progressive multifocal leukoencephalopathy | 25 | 4.233 | 2.1 |
Phaeochromocytoma | 20 | 3.541 | 1.8 |
Disease | log2 FC | p |
---|---|---|
active Crohn's disease | 1.380 | 4.2e-02 |
active ulcerative colitis | 1.491 | 3.8e-02 |
adrenocortical carcinoma | 1.365 | 3.9e-02 |
atypical teratoid/rhabdoid tumor | -1.100 | 3.4e-03 |
Breast cancer | -1.300 | 5.4e-14 |
colon cancer | -1.200 | 3.4e-03 |
ductal carcinoma in situ | -1.200 | 2.9e-02 |
group 3 medulloblastoma | -1.500 | 4.3e-02 |
intraductal papillary-mucinous adenoma (... | -1.600 | 3.5e-03 |
intraductal papillary-mucinous carcinoma... | -1.800 | 3.8e-03 |
intraductal papillary-mucinous neoplasm ... | -1.800 | 1.8e-02 |
invasive ductal carcinoma | -2.000 | 2.5e-03 |
lung adenocarcinoma | -1.200 | 1.3e-14 |
lung cancer | -2.200 | 2.9e-04 |
lung carcinoma | -1.200 | 2.0e-10 |
malignant mesothelioma | 1.700 | 2.7e-06 |
medulloblastoma, large-cell | -3.000 | 1.6e-06 |
non-small cell lung cancer | -1.063 | 6.1e-07 |
subependymal giant cell astrocytoma | -1.198 | 1.8e-02 |
tuberculosis | -1.600 | 4.4e-04 |
type I diabetes mellitus | -1.131 | 2.6e-02 |
Species | Source | Disease |
---|---|---|
OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA |
MEAPLVSLDEEFEDLRPSCSEDPEEKPQCFYGSSPHHLEDPSLSELENFSSEIISFKSMEDLVNEFDEKL 1 - 70 NVCFRNYNAKTENLAPVKNQLQIQEEEETLQDEEVWDALTDNYIPSLSEDWRDPNIEALNGNCSDTEIHE 71 - 140 KEEEEFNEKSENDSGINEEPLLTADQVIEEIEEMMQNSPDPEEEEEVLEEEDGGETSSQADSVLLQEMQA 141 - 210 LTQTFNNNWSYEGLRHMSGSELTELLDQVEGAIRDFSEELVQQLARRDELEFEKEVKNSFITVLIEVQNK 211 - 280 QKEQRELMKKRRKEKGLSLQSSRIEKGNQMPLKRFSMEGISNILQSGIRQTFGSSGTDKQYLNTVIPYEK 281 - 350 KASPPSVEDLQMLTNILFAMKEDNEKVPTLLTDYILKVLCPT 351 - 392 //