Property Summary

NCBI Gene PubMed Count 18
PubMed Score 68.50
PubTator Score 169.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Myocardial Ischemia 169
Disease Target Count P-value
ovarian cancer 8491 7.8e-08
medulloblastoma, large-cell 6234 6.1e-05
osteosarcoma 7933 3.0e-04
pituitary cancer 1972 1.2e-02
medulloblastoma 1524 2.2e-02
adult high grade glioma 2148 2.6e-02
Disease Target Count Z-score Confidence
Ewing sarcoma 27 0.0 5.0
Disease Target Count
Sudden infant death syndrome 34

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 1.081 3.0e-04
medulloblastoma 1.500 2.2e-02
medulloblastoma, large-cell 2.300 6.1e-05
adult high grade glioma 1.200 2.6e-02
ovarian cancer 1.100 7.8e-08
pituitary cancer 1.500 1.2e-02

Gene RIF (14)

PMID Text
26122139 Genetic variation in FEV1 was associated with serum 25-Hydroxyvitamin D status.
24100022 novel evidence for the role of Pet-1 in human amygdala threat processing extends literature demonstrating the influence of genetic variation in the serotonin system on emotional regulation
23591790 Fev-ERK signaling is essential for hemogenic endothelium-based hematopoietic stem cell development.
20546612 Observational study of gene-disease association. (HuGE Navigator)
20480378 our data argue against an exclusive role of FEV in the adult human brain serotonergic system and genetic analyses did not suggest that FEV variation adds to the genetic liability towards affective disorders
20468064 Observational study of gene-disease association. (HuGE Navigator)
20048018 FEV identifies serotonin-producing cells in normal and neoplastic small intestine.
19874574 Observational study of gene-disease association. (HuGE Navigator)
19707175 Serotonin-related FEV gene variant in the sudden infant death syndrome is a common polymorphism in the African-American population.
19707175 Observational study of gene-disease association. (HuGE Navigator)
17597646 Variation in FEV gene observed exclusively in a subset of African American sudden infant death syndrome cases may help explain the observed abnormalities of this system in some SIDS cases and the ethnic disparity.
15758173 Analysis of transgene expression in Pet-1 null mice indicates that Pet-1 is required to maintain the activity of the Pet-1 enhancer region in a subset of serotonin (5-HT) neurons.
15003288 We showed that fev is exclusively expressed in the midline part of the human brainstem containing raphe nuclei, which also specifically expressed 5-HT transporter (sert) and tryptophan hydroxylase (tph), two markers of the 5-HT neurotransmitter system.
12761502 FEV acts as a transcriptional repressor through its DNA-binding ETS domain and alanine-rich domain.

AA Sequence

MRQSGASQPLLINMYLPDPVGDGLFKDGKNPSWGPLSPAVQKGSGQIQLWQFLLELLADRANAGCIAWEG      1 - 70
GHGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYRFDFQGLAQACQPPPA     71 - 140
HAHAAAAAAAAAAAAQDGALYKLPAGLAPLPFPGLSKLNLMAASAGVAPAGFSYWPGPGPAATAAAATAA    141 - 210
LYPSPSLQPPPGPFGAVAAASHLGGHYH                                              211 - 238
//

Text Mined References (22)

PMID Year Title
26122139 2015 Association of 25-Hydroxyvitamin D status and genetic variation in the vitamin D metabolic pathway with FEV1 in the Framingham Heart Study.
24100022 2013 Convergent effects of mouse Pet-1 deletion and human PET-1 variation on amygdala fear and threat processing.
23591790 2013 Fev regulates hematopoietic stem cell development via ERK signaling.
22542470 2012 Genome-wide association study of antibody response to smallpox vaccine.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
20480378 2010 The expression of the transcription factor FEV in adult human brain and its association with affective disorders.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20048018 2010 The ETS oncogene family transcription factor FEV identifies serotonin-producing cells in normal and neoplastic small intestine.
19874574 2009 Genetical genomic determinants of alcohol consumption in rats and humans.
19707175 2009 Serotonin-related FEV gene variant in the sudden infant death syndrome is a common polymorphism in the African-American population.
18391951 2008 Many sequence variants affecting diversity of adult human height.
17597646 2007 Sudden infant death syndrome: rare mutation in the serotonin system FEV gene.
17172842 2006 Expression of EWS-ETS fusions in NIH3T3 cells reveals significant differences to Ewing's sarcoma.
15986391 2005 Regional distribution and cellular localization of the ETS-domain transcription factor, FEV, mRNA in the human postmortem brain.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15758173 2005 A differentially autoregulated Pet-1 enhancer region is a critical target of the transcriptional cascade that governs serotonin neuron development.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15003288 2004 The Ets transcription factor Fev is specifically expressed in the human central serotonergic neurons.
12761502 2003 FEV acts as a transcriptional repressor through its DNA-binding ETS domain and alanine-rich domain.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10949935 2000 A novel zinc finger gene is fused to EWS in small round cell tumor.
9121764 1997 A new member of the ETS family fused to EWS in Ewing tumors.