Property Summary

NCBI Gene PubMed Count 76
PubMed Score 985.43
PubTator Score 40.15

Knowledge Summary

Patent (46,744)

TINX Plot

  Disease (4)

Disease Target Count P-value
osteosarcoma 7933 5.0e-08
tuberculosis 1563 5.1e-05
Disease Target Count Z-score Confidence
Essential Hypertension 82 0.0 2.0
Disease Target Count Z-score Confidence
Cancer 2346 3.405 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.502 5.0e-08
tuberculosis 1.300 5.1e-05

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (27)

PMID Text
23404507 analysis of the JAK-Fes-phospholipase D signaling pathway that is enhanced in highly proliferative breast cancer cells
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20117079 FES kinase is a mediator of wild-type KIT signalling implicated in cell migration.
20030920 c-fes gene expression was found in myeloid leukemias, whereas low or no expression in lymphocytic leukemias.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19885553 FGF-2 activates Fes via the second coiled-coil domain, leading to lamellipodium formation and chemotaxis by endothelial cells
19865112 Observational study of gene-disease association. (HuGE Navigator)
19464057 Observational study of gene-disease association. (HuGE Navigator)
19382747 c-Fes oligomerization is independent of activation; data suggest that conformational changes, rather than oligomerization, govern c-Fes kinase activation and downstream signaling in vivo.
19082481 Downregulation of the c-Fes protein-tyrosine kinase inhibits the proliferation of renal carcinoma.
19051325 Study of promoter methylation as important mechanism responsible for downregulation of FES gene expression in colorectal cancer cells. Treatment with DNA methyltransferase inhibitor resulted in expression of functional FES transcripts in CRC cell lines.
19001085 study shows Fes phosphorylates C-terminal tyrosine residues in HS1 implicated in actin stabilization; coordinated action of F-BAR & SH2 domains of Fes allow for coupling to FcepsilonRI signaling & potential regulation of actin reorganization in mast cells
18775312 The SH2 and catalytic domains of active Fes and Abl pro-oncogenic kinases form integrated structures essential for effective tyrosine kinase signaling.
18046454 Ezrin/Fes interaction at cell-cell contacts plays an essential role in hepatocyte growth factor-induced cell scattering and implicates Fes in the cross-talk between cell-cell and cell-matrix adhesion.
17595334 shows a major function of FES downstream of activated KIT receptor and thereby points to FES as a novel target in KIT-related pathologi
17521372 These novel results indicate the involvement of Fes in VEGF-A-induced cellular responses by cultured endothelial cells.
16792528 A novel Fes-KAP-1 interaction is reported, suggesting a dual role for KAP-1 as both a Fes activator and downstream effector.
16455651 FES has a growth suppressive function in colorectal neoplasms.
15929003 NMR analysis of Src homology 2 domain from the human feline sarcoma oncogene Fes
15713745 PEDF downregulates Fyn through Fes, resulting in inhibition of FGF-2-induced capillary morphogenesis of endothelial cells
15630569 NMR assignment of the SH2 domain
15485904 c-Fes is a regulator of the tubulin cytoskeleton and may contribute to Fes-induced morphological changes in myeloid hematopoietic and neuronal cells
15099290 FPS mediates enhanced sensitization to VEGF and PDGF signaling in ECs; this hypersensitization contributes to excessive angiogenic signaling and underlies the observed hypervascular phenotype of human myristoylated FPS expressed in transgenic mice.
15003822 Fes transduces inductive signals for terminal macrophage and granulocyte differentiation, and this biological activity is mediated through the activation of lineage-specific transcription factors.
12871378 Fps/Fes and Fer are expressed in human and mouse platelets, and are activated following stimulation with collagen and collagen-related peptide (CRP), suggesting a role in GPVI receptor signaling
12653561 Fes naturally adopts an inactive conformation in vivo, and maintenance of the inactive structure requires the coiled-coil and SH2 domains.
11994747 Closing in on the biological functions of Fps/Fes and Fer. A review.

AA Sequence

MGFSSELCSPQGHGVLQQMQEAELRLLEGMRKWMAQRVKSDREYAGLLHHMSLQDSGGQSRAISPDSPIS      1 - 70
QSWAEITSQTEGLSRLLRQHAEDLNSGPLSKLSLLIRERQQLRKTYSEQWQQLQQELTKTHSQDIEKLKS     71 - 140
QYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLR    141 - 210
SLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAAAAARIQPEAEYQGFLRQYGSAPDVPPCVTF    211 - 280
DESLLEEGEPLEPGELQLNELTVESVQHTLTSVTDELAVATEMVFRRQEMVTQLQQELRNEEENTHPRER    281 - 350
VQLLGKRQVLQEALQGLQVALCSQAKLQAQQELLQTKLEHLGPGEPPPVLLLQDDRHSTSSSEQEREGGR    351 - 420
TPTLEILKSHISGIFRPKFSLPPPLQLIPEVQKPLHEQLWYHGAIPRAEVAELLVHSGDFLVRESQGKQE    421 - 490
YVLSVLWDGLPRHFIIQSLDNLYRLEGEGFPSIPLLIDHLLSTQQPLTKKSGVVLHRAVPKDKWVLNHED    491 - 560
LVLGEQIGRGNFGEVFSGRLRADNTLVAVKSCRETLPPDLKAKFLQEARILKQYSHPNIVRLIGVCTQKQ    561 - 630
PIYIVMELVQGGDFLTFLRTEGARLRVKTLLQMVGDAAAGMEYLESKCCIHRDLAARNCLVTEKNVLKIS    631 - 700
DFGMSREEADGVYAASGGLRQVPVKWTAPEALNYGRYSSESDVWSFGILLWETFSLGASPYPNLSNQQTR    701 - 770
EFVEKGGRLPCPELCPDAVFRLMEQCWAYEPGQRPSFSTIYQELQSIRKRHR                      771 - 822
//

Text Mined References (86)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23404507 2013 A new signaling pathway (JAK-Fes-phospholipase D) that is enhanced in highly proliferative breast cancer cells.
21909115 2011 Genetic variants in novel pathways influence blood pressure and cardiovascular disease risk.
21909110 2011 Genome-wide association study identifies six new loci influencing pulse pressure and mean arterial pressure.
21622225 2011 Structure and regulation of the c-Fes protein-tyrosine kinase.
21563194 2012 Pathological significance and predictive value for biochemical recurrence of c-Fes expression in prostate cancer.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20117079 2010 FES kinase participates in KIT-ligand induced chemotaxis.
20111072 2010 FES kinases are required for oncogenic FLT3 signaling.
20030920 2009 [Expression of c-fes gene in leukemia cells and its clinical significance].
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19885553 2009 Inhibition of endothelial cell chemotaxis toward FGF-2 by gefitinib associates with downregulation of Fes activity.
19865112 2010 Mutual exclusion of ASXL1 and NPM1 mutations in a series of acute myeloid leukemias.
19464057 2009 A high-throughput candidate gene mutation screen in lymphoproliferative and myeloproliferative neoplasias.
19382747 2009 Bimolecular fluorescence complementation demonstrates that the c-Fes protein-tyrosine kinase forms constitutive oligomers in living cells.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19082481 2009 Downregulation of the c-Fes protein-tyrosine kinase inhibits the proliferation of human renal carcinoma cells.
19051325 2009 Promoter methylation blocks FES protein-tyrosine kinase gene expression in colorectal cancer.
19001085 2009 Contributions of F-BAR and SH2 domains of Fes protein tyrosine kinase for coupling to the FcepsilonRI pathway in mast cells.
18775312 2008 Structural coupling of SH2-kinase domains links Fes and Abl substrate recognition and kinase activation.
18046454 2008 Spatial recruitment and activation of the Fes kinase by ezrin promotes HGF-induced cell scattering.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17595334 2007 The tyrosine kinase FES is an essential effector of KITD816V proliferation signal.
17521372 Downregulation of Fes inhibits VEGF-A-induced chemotaxis and capillary-like morphogenesis by cultured endothelial cells.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16792528 2006 The KRAB-associated co-repressor KAP-1 is a coiled-coil binding partner, substrate and activator of the c-Fes protein tyrosine kinase.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16455651 2006 A growth-suppressive function for the c-fes protein-tyrosine kinase in colorectal cancer.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15929003 2005 Solution structure of the Src homology 2 domain from the human feline sarcoma oncogene Fes.
15869408 2005 Expression of c-Fes protein isoforms correlates with differentiation in myeloid leukemias.
15869325 2005 A scan for positively selected genes in the genomes of humans and chimpanzees.
15867340 2005 An identity crisis for fps/fes: oncogene or tumor suppressor?
15713745 2005 Pigment epithelium-derived factor inhibits fibroblast-growth-factor-2-induced capillary morphogenesis of endothelial cells through Fyn.
15630569 2004 NMR assignment of the SH2 domain from the human feline sarcoma oncogene FES.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485904 2004 The human c-Fes tyrosine kinase binds tubulin and microtubules through separate domains and promotes microtubule assembly.
15302586 2004 The c-Fes tyrosine kinase cooperates with the breakpoint cluster region protein (Bcr) to induce neurite extension in a Rac- and Cdc42-dependent manner.
15099290 2004 Vascular defects in gain-of-function fps/fes transgenic mice correlate with PDGF- and VEGF-induced activation of mutant Fps/Fes kinase in endothelial cells.
15003822 The Fes tyrosine kinase: a signal transducer that regulates myeloid-specific gene expression through transcriptional activation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12871378 2003 Fps/Fes and Fer non-receptor protein-tyrosine kinases regulate collagen- and ADP-induced platelet aggregation.
12653561 2003 Regulation of c-Fes tyrosine kinase activity by coiled-coil and SH2 domains: analysis with Saccharomyces cerevisiae.
12543931 2002 Toward a human blood serum proteome: analysis by multidimensional separation coupled with mass spectrometry.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12093729 2002 Involvement of Fes/Fps tyrosine kinase in semaphorin3A signaling.
11994747 2002 Closing in on the biological functions of Fps/Fes and Fer.
11700021 2001 HSH2: a novel SH2 domain-containing adapter protein involved in tyrosine kinase signaling in hematopoietic cells.
11604131 2001 Plexin signaling via off-track and rho family GTPases.
11509660 2001 A point mutation in the N-terminal coiled-coil domain releases c-Fes tyrosine kinase activity and survival signaling in myeloid leukemia cells.
11339827 2001 Subcellular localization analysis of the closely related Fps/Fes and Fer protein-tyrosine kinases suggests a distinct role for Fps/Fes in vesicular trafficking.
11160325 2001 Fes mediates the IL-4 activation of insulin receptor substrate-2 and cellular proliferation.
11071635 2000 Stem cell factor induces phosphatidylinositol 3'-kinase-dependent Lyn/Tec/Dok-1 complex formation in hematopoietic cells.
10856136 2000 IL-4/IL-13 signaling beyond JAK/STAT.
9754447 1998 The c-Fes family of protein-tyrosine kinases.
9714332 1998 c-Fes tyrosine kinase binds to and activates STAT3 after granulocyte-macrophage colony-stimulating factor stimulation.
8999909 1997 The Fes protein-tyrosine kinase phosphorylates a subset of macrophage proteins that are involved in cell adhesion and cell-cell signaling.
8955135 1996 Co-expression with BCR induces activation of the FES tyrosine kinase and phosphorylation of specific N-terminal BCR tyrosine residues.
8916957 1996 Interleukin-4 induces association of the c-fes proto-oncogene product with phosphatidylinositol-3 kinase.
8663427 1996 Autophosphorylation of the Fes tyrosine kinase. Evidence for an intermolecular mechanism involving two kinase domain tyrosine residues.
8631962 1996 Granulocyte-macrophage colony-stimulating factor stimulates JAK2 signaling pathway and rapidly activates p93fes, STAT1 p91, and STAT3 p92 in polymorphonuclear leukocytes.
8449035 1993 Confirmation of 15q26.1 as the site of the FES protooncogene by fluorescence in situ hybridization.
8108116 1994 c-fes expression in ontogenetic development and hematopoietic differentiation.
8007965 1994 Functional specificity of cytoplasmic and transmembrane tyrosine kinases: identification of 130- and 75-kilodalton substrates of c-fps/fes tyrosine kinase in macrophages.
7700650 1995 Human c-FES is a nuclear tyrosine kinase.
7691175 1993 Phosphorylation of the ras GTPase-activating protein (GAP) by the p93c-fes protein-tyrosine kinase in vitro and formation of GAP-fes complexes via an SH2 domain-dependent mechanism.
7687763 1993 Regulation of the human c-fes protein tyrosine kinase (p93c-fes) by its src homology 2 domain and major autophosphorylation site (Tyr-713).
7529874 1995 Tyrosine phosphorylation of BCR by FPS/FES protein-tyrosine kinases induces association of BCR with GRB-2/SOS.
7523858 1994 The Fps/Fes protein-tyrosine kinase promotes angiogenesis in transgenic mice.
7518439 1994 Interaction of the c-fes proto-oncogene product with the interleukin-4 receptor.
6323103 1984 Localization of the cellular oncogenes ABL, SIS, and FES on human germ-line chromosomes.
6264598 1981 Three distinct genes in human DNA related to the transforming genes of mammalian sarcoma retroviruses.
6183005 1982 Nucleotide sequences of feline retroviral oncogenes (v-fes) provide evidence for a family of tyrosine-specific protein kinase genes.
4065096 1985 The structure of the human c-fes/fps proto-oncogene.
3947550 1986 Cellular levels of mRNA from c-myc, c-myb and c-fes onc-genes in normal myeloid and erythroid precursors of human bone marrow: an in situ hybridization study.
3488499 1986 Characterization of human c-fes/fps reveals a new transcription unit (fur) in the immediately upstream region of the proto-oncogene.
2656706 1989 K562 leukemia cells transfected with the human c-fes gene acquire the ability to undergo myeloid differentiation.
2426571 1985 Expression of the mammalian c-fes protein in hematopoietic cells and identification of a distinct fes-related protein.
2179816 1990 Characterization of human and mouse c-fes cDNA clones and identification of the 5' end of the gene.
1870997 1991 An insertion deletion polymorphism associated with C-FES.
1862005 1991 Tetranucleotide repeat polymorphism at the human c-fes/fps proto-oncogene (FES).
1373879 1992 Expression of truncated transcripts of the proto-oncogene c-fps/fes in human lymphoma and lymphoid leukemia cell lines.