Property Summary

NCBI Gene PubMed Count 56
PubMed Score 71.65
PubTator Score 68.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -2.095 2.1e-03
non-small cell lung cancer -1.362 4.8e-14
interstitial cystitis 1.700 6.6e-04
subependymal giant cell astrocytoma 1.791 1.1e-02
lung carcinoma -1.500 2.5e-23

 GO Function (1)

Protein-protein Interaction (2)

Gene RIF (45)

PMID Text
27101375 NMR studies demonstrated that the F1 loop of kindlin-3 is globally unfolded but stretches of residues assuming transient helical conformations could be detected in aqueous solution.
26994136 kindlin-3 plays an important role in maintaining a proper conformation of the resting alpha4beta1 to mediate both rolling and firm cell adhesion
26677948 Kindlin-3 regulates c-Myc protein expression in the human chronic myeloid leukemia cell line K562.
26334393 Suppression of the Kindlin-2-integrin beta1-AKT regulatory axis is an alternative mechanism underlying the tumor suppressor function of miR-200b in esophageal squamous cell carcinoma.
26282877 The accumulation of HSPCs in the circulation of leukocyte adhesion deficiency type III patients, who lack Kindlin-3, underlines the conserved functions of Kindlin-3 in man and the importance of our findings for human disease.
26188538 Kindlin-3/FERMT3 is upregulated in atherosclerotic, mainly in cells of monocytic origin and of M2 type. Simultaneous upregulation of ITGB2 suggests a synergistic effect on leukocyte adherence and transmigration into the vessel wall.
25854317 A new C>T point mutation was found in exon 13 in the FERMT3 gene in an infant diagnosed with LAD-III. KINDLIN-3 expression is required for platelet aggregation and leukocyte function, but also osteoclast-mediated bone resorption.
25724625 High Kindlin-2 expression promotes pancreatic ductal adenocarcinoma progression.
25609252 These data identify a role of kindlin-3 phosphorylation in integrin b3 activation and provide a basis for functional differences between kindlin-3 and the two other kindlin paralogs.
25344860 The data uncover a novel and unexpected tumor suppressor role of Kindlin-3 which can influence integrins targeted therapies development.
25237194 kindlin-2 tyrosine phosphorylation and interaction with Src serve as a regulatable switch downstream of focal adhesion kinase in the integrin outside-in signaling circuit controlling cell migration and proliferation
25152024 Mig-2 significantly attenuates the antitumor action of cisplatin.
24615351 Direct activation of RhoA with recombinant bacterial cytotoxic necrotizing factor y reverted the abnormal phenotype and barrier function of kindlin-2-deficient keratinocytes and skin equivalents.
24583125 While Kindlin-2 was highly expressed in control tissues, a drastic low expression of Kindlin-2 was found in the tumor tissues of serous epithelial ovarian cancer, especially in high-grade serous epithelial ovarian cancer.
24523237 ADAP interacts with talin and kindlin-3 to promote platelet Integrin alphaIIbbeta3 activation and stable fibrinogen binding.
24469992 Kindlin-3 influences breast cancer progression by influencing the crosstalk between beta1 integrins and Twist to increase VEGF production, which enhances breast cancer cell invasion and tumor angiogenesis and metastasis
24336678 Kindlin 2 expression was significantly increased in luteinized granulosa cells from patients with polycystic ovary syndrome.
24010654 kindlin-3-mediated high-affinity LFA-1 controls both the early transient integrin-dependent adhesions in addition to the final stable adhesions made under flow conditions
23823319 the beta-2-integrin-kindlin-3 interaction is particularly important in adhesion strengthening under shear flow, and for T-cell homing to lymph nodes, but dispensable for T cell activation which occurs in a shear-free environment
23595985 the correct functioning of the kindlin 3 PH domain is central to the role that kindlin 3 performs in guiding lymphocyte adhesion and motility behavior, which in turn is required for a successful immune response.
23437269 kindlin-3 is required for the integrin alphaMbeta2-Syk-Vav1 signaling axis that regulates Rac1 and Cdc42 activities. These findings reinforce a role for kindlin-3 in integrin outside-in signaling.
23144497 Multivalent LFA-1/ICAM-1 bonds serve as mechanosensors that direct PMN cytoskeletal activity by transmission of tensile force to a supramolecular complex that triggers Ca2+ influx at sites of adhesive contact.
23022222 Agonist stimulation, talin-1, and kindlin-3 are crucial for alpha(IIb)beta(3) activation in a human megakaryoblastic cell line, CMK.
23012377 cleavage of Kindlin-3 by calpain controls the dynamics of integrin-Kindlin-3 interaction and as a result, integrin-dependent adhesion and migration of hematopoietic cells.
22983444 kindlin-3 lowers the threshold for NK cell activation. Loss of kindlin-3 has a pronounced effect on NK cell-mediated cytotoxicity triggered by single activating receptors.
22564402 Kindlin-3 deficiency impairs integrin function, including activation of beta(1) integrin. Abnormalities in glycoprotein Ib-IX function in Kindlin-3-deficient platelets are secondary to integrin defects
22334666 integrin alphaLbeta2 engagement by its ligand ICAM-1 promotes the association of kindlin-3 with RACK1
22139635 A new mutation in codon 476 of exon 12, CAG-->TAG was found in 2 siblings with Leukocyte adhesion deficiency-I variant syndrome.
22134107 LAD-III syndrome is caused by mutations in FERMT3, encoding the kindlin-3 protein in all blood cells that is involved in the regulation of beta integrin conformation. (Review)
21911599 We investigated the role of talin-1, kindlin-3, and alpha-actinin-1 in the upregulation of alpha(4)beta(1) integrin affinity and consequent inflammatory leukocyte adhesive events
21871525 TIIICBP and kindlin-3 could be the same protein and propose a key role for kindlin-3 in platelet activation by type III collagen.
21536861 investigation into roles of kindlin-3 in activated T-cells: facilitates multimerization of LFA-1/ICAM-1; increases stability of focal LFA-1 contacts (presumably at immunological synapses)and anchors to cytoskeleton; facilitates T-cell spreading
20378539 integrin co-activator Kindlin-3 is expressed and functional in a non-hematopoietic cell, the endothelial cell
20357244 LAD-III patient mutations have highlighted functionally important regions of kindlin-3 that alter leukocyte integrin-dependent function in 2 distinct ways.
20216991 in two brothers with LAD-III syndrome homozygous mutation 1717C>T causes integrin-dependent platelet dysfunction in siblings with leukocyte adhesion deficiency-III
19854292 cellular functions and possible clinical relevance of kindlin-3 [REVIEW]
19647987 Studies indicate that LAD I is due to the mutations in beta2-integrin essential for firm adhesion.
19617577 Kindlin-3 is more critical to LFA-1 than to VLA-4-adhesive functions in human lymphocytes.
19240021 Kindlin-1 and -2 directly bind the C-terminal region of beta integrin cytoplasmic tails and exert integrin-specific activation effects
19234463 identify mutations in the KINDLIN3 (official symbol FERMT3) gene specifying the KINDLIN-3 protein as the cause of leukocyte adhesion deficiency-III in Maltese and Turkish subjects
19234461 Kindlin-3 is essential to activate the beta1, beta2 and beta3 integrin classes, and loss of Kindlin-3 function is sufficient to cause a LAD-III-like phenotype in mice
19064721 Mutations in FERMT3 is associated with Leukocyte adhesion deficiency syndrome.
18779414 the LAD-III phenotype could manifest a combined defect in both upstream and downstream integrin regulatory effectors CalDAG-GEFI and Kindlin-3
18280249 our data show for the first time that URP2SF may act as a transcriptional repressor in NF-kappaB signaling pathway and regulate cell apoptotic pathway.
12886250 expressed preferentially in B cells; MIG2B is in a highly conserved and defined gene family containing two plasma-membrane-binding ezrin/radixin/moesin domains and a pleckstrin homology domain

AA Sequence

MAGMKTASGDYIDSSWELRVFVGEEDPEAESVTLRVTGESHIGGVLLKIVEQINRKQDWSDHAIWWEQKR      1 - 70
QWLLQTHWTLDKYGILADARLFFGPQHRPVILRLPNRRALRLRASFSQPLFQAVAAICRLLSIRHPEELS     71 - 140
LLRAPEKKEKKKKEKEPEEELYDLSKVVLAGGVAPALFRGMPAHFSDSAQTEACYHMLSRPQPPPDPLLL    141 - 210
QRLPRPSSLSDKTQLHSRWLDSSRCLMQQGIKAGDALWLRFKYYSFFDLDPKTDPVRLTQLYEQARWDLL    211 - 280
LEEIDCTEEEMMVFAALQYHINKLSQSGEVGEPAGTDPGLDDLDVALSNLEVKLEGSAPTDVLDSLTTIP    281 - 350
ELKDHLRIFRIPRRPRKLTLKGYRQHWVVFKETTLSYYKSQDEAPGDPIQQLNLKGCEVVPDVNVSGQKF    351 - 420
CIKLLVPSPEGMSEIYLRCQDEQQYARWMAGCRLASKGRTMADSSYTSEVQAILAFLSLQRTGSGGPGNH    421 - 490
PHGPDASAEGLNPYGLVAPRFQRKFKAKQLTPRILEAHQNVAQLSLAEAQLRFIQAWQSLPDFGISYVMV    491 - 560
RFKGSRKDEILGIANNRLIRIDLAVGDVVKTWRFSNMRQWNVNWDIRQVAIEFDEHINVAFSCVSASCRI    561 - 630
VHEYIGGYIFLSTRERARGEELDEDLFLQLTGGHEAF                                     631 - 667
//

Text Mined References (62)

PMID Year Title
27101375 2016 NMR Characterization and Membrane Interactions of the Loop Region of Kindlin-3 F1 Subdomain.
26994136 2016 Kindlin-3 Is Essential for the Resting ?4?1 Integrin-mediated Firm Cell Adhesion under Shear Flow Conditions.
26677948 2015 Kindlin-3 interacts with the ribosome and regulates c-Myc expression required for proliferation of chronic myeloid leukemia cells.
26359933 2016 Adaptive immune defects in a patient with leukocyte adhesion deficiency type III with a novel mutation in FERMT3.
26334393 2015 Loss of miR-200b promotes invasion via activating the Kindlin-2/integrin ?1/AKT pathway in esophageal squamous cell carcinoma: An E-cadherin-independent mechanism.
26282877 2015 Kindlin-3-mediated integrin adhesion is dispensable for quiescent but essential for activated hematopoietic stem cells.
26188538 2015 Kindlin 3 (FERMT3) is associated with unstable atherosclerotic plaques, anti-inflammatory type II macrophages and upregulation of beta-2 integrins in all major arterial beds.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25854317 2015 A new mutation in the KINDLIN-3 gene ablates integrin-dependent leukocyte, platelet, and osteoclast function in a patient with leukocyte adhesion deficiency-III.
25724625 2015 Kindlin-2 induced by TGF-? signaling promotes pancreatic ductal adenocarcinoma progression through downregulation of transcriptional factor HOXB9.
25609252 2015 Site-specific phosphorylation of kindlin-3 protein regulates its capacity to control cellular responses mediated by integrin ?IIb?3.
25344860 2014 A novel tumor suppressor function of Kindlin-3 in solid cancer.
25237194 2014 Kindlin-2 tyrosine phosphorylation and interaction with Src serve as a regulatable switch in the integrin outside-in signaling circuit.
25152024 2014 Mig-2 attenuates cisplatin-induced apoptosis of human glioma cells in vitro through AKT/JNK and AKT/p38 signaling pathways.
24615351 2014 RhoA activation by CNFy restores cell-cell adhesion in kindlin-2-deficient keratinocytes.
24583125 2014 Kindlin-2 inhibits serous epithelial ovarian cancer peritoneal dissemination and predicts patient outcomes.
24523237 2014 ADAP interactions with talin and kindlin promote platelet integrin ?IIb?3 activation and stable fibrinogen binding.
24469992 2014 Kindlin-3 enhances breast cancer progression and metastasis by activating Twist-mediated angiogenesis.
24336678 2014 Increased expression of kindlin 2 in luteinized granulosa cells correlates with androgen receptor level in patients with polycystic ovary syndrome having hyperandrogenemia.
24010654 2013 Novel automated tracking analysis of particles subjected to shear flow: kindlin-3 role in B cells.
23823319 2013 The ?2 integrin-kindlin-3 interaction is essential for T-cell homing but dispensable for T-cell activation in vivo.
23595985 2013 The kindlin 3 pleckstrin homology domain has an essential role in lymphocyte function-associated antigen 1 (LFA-1) integrin-mediated B cell adhesion and migration.
23437269 2013 A role of kindlin-3 in integrin ?M?2 outside-in signaling and the Syk-Vav1-Rac1/Cdc42 signaling axis.
23382103 2013 Platelet proteome analysis reveals integrin-dependent aggregation defects in patients with myelodysplastic syndromes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23144497 2012 Leukocyte function antigen-1, kindlin-3, and calcium flux orchestrate neutrophil recruitment during inflammation.
23022222 2013 Agonist stimulation, talin-1, and kindlin-3 are crucial for ?(IIb)?(3) activation in a human megakaryoblastic cell line, CMK.
23012377 2012 Regulation of cell adhesion and migration by Kindlin-3 cleavage by calpain.
22983444 2012 Loss of kindlin-3 alters the threshold for NK cell activation in human leukocyte adhesion deficiency-III.
22564402 2012 Novel aspects of Kindlin-3 function in humans based on a new case of leukocyte adhesion deficiency III.
22334666 2012 Kindlin-3 mediates integrin ?L?2 outside-in signaling, and it interacts with scaffold protein receptor for activated-C kinase 1 (RACK1).
22139635 2012 Leukocyte adhesion deficiency-I variant syndrome (LAD-Iv, LAD-III): molecular characterization of the defect in an index family.
22134107 2012 Hematologically important mutations: leukocyte adhesion deficiency (first update).
21911599 2011 Talin-1 and kindlin-3 regulate alpha4beta1 integrin-mediated adhesion stabilization, but not G protein-coupled receptor-induced affinity upregulation.
21871525 2012 Platelet type III collagen binding protein (TIIICBP) presents high biochemical and functional similarities with kindlin-3.
21784300 2011 Genome-wide association study of the child behavior checklist dysregulation profile.
21536861 2011 Kindlin-3 is required for the stabilization of TCR-stimulated LFA-1:ICAM-1 bonds critical for lymphocyte arrest and spreading on dendritic cells.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20378539 2010 The integrin co-activator Kindlin-3 is expressed and functional in a non-hematopoietic cell, the endothelial cell.
20357244 2010 Two mutations in the KINDLIN3 gene of a new leukocyte adhesion deficiency III patient reveal distinct effects on leukocyte function in vitro.
20216991 2010 Novel integrin-dependent platelet malfunction in siblings with leukocyte adhesion deficiency-III (LAD-III) caused by a point mutation in FERMT3.
19946888 2010 Defining the membrane proteome of NK cells.
19854292 2010 The role of kindlins in cell biology and relevance to human disease.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19647987 2009 Genetic etiologies of leukocyte adhesion defects.
19617577 2009 Loss of Kindlin-3 in LAD-III eliminates LFA-1 but not VLA-4 adhesiveness developed under shear flow conditions.
19240021 2009 Kindlin-1 and -2 directly bind the C-terminal region of beta integrin cytoplasmic tails and exert integrin-specific activation effects.
19234463 2009 Leukocyte adhesion deficiency-III is caused by mutations in KINDLIN3 affecting integrin activation.
19234461 2009 Kindlin-3 is required for beta2 integrin-mediated leukocyte adhesion to endothelial cells.
19234460 2009 A point mutation in KINDLIN3 ablates activation of three integrin subfamilies in humans.
19064721 2009 LAD-1/variant syndrome is caused by mutations in FERMT3.
18779414 2008 Kindlin-3: a new gene involved in the pathogenesis of LAD-III.
18280249 2008 URP2SF, a FERM and PH domain containing protein, regulates NF-kappaB and apoptosis.
18088087 2008 Phosphoproteome of resting human platelets.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231747 2004 A protein interaction framework for human mRNA degradation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12886250 2003 Proteomic analysis of the cell-surface membrane in chronic lymphocytic leukemia: identification of two novel proteins, BCNP1 and MIG2B.
12789646 2003 Loss of kindlin-1, a human homolog of the Caenorhabditis elegans actin-extracellular-matrix linker protein UNC-112, causes Kindler syndrome.
12697302 2003 URP1: a member of a novel family of PH and FERM domain-containing membrane-associated proteins is significantly over-expressed in lung and colon carcinomas.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.