Property Summary

NCBI Gene PubMed Count 48
PubMed Score 71.99
PubTator Score 63.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
psoriasis -1.400 1.2e-06
osteosarcoma 2.410 2.1e-04
cystic fibrosis -1.699 8.2e-05
medulloblastoma, large-cell -1.200 1.3e-03
Atopic dermatitis -1.400 1.7e-03
tuberculosis -1.100 2.8e-05
primary pancreatic ductal adenocarcinoma 1.786 1.4e-03
non-small cell lung cancer -1.534 1.5e-14
intraductal papillary-mucinous adenoma (... -3.000 2.0e-03
intraductal papillary-mucinous carcinoma... -3.800 1.4e-03
intraductal papillary-mucinous neoplasm ... -3.700 1.1e-02
lung cancer -1.200 4.7e-02
colon cancer -2.700 1.0e-03
breast carcinoma -1.300 4.2e-17
fibroadenoma -1.400 3.9e-02
lung adenocarcinoma -1.400 4.3e-17
pilocytic astrocytoma 1.100 3.4e-04
lung carcinoma -1.200 2.8e-10
Breast cancer -1.500 1.5e-07
ductal carcinoma in situ -2.000 1.3e-03
invasive ductal carcinoma -2.300 2.8e-03
ulcerative colitis 2.300 5.6e-05
ovarian cancer -3.000 9.7e-09
pituitary cancer -1.200 2.7e-04
Down syndrome 1.600 7.3e-04
pancreatic cancer 1.700 1.7e-03
dermatomyositis 1.400 8.5e-04

Protein-protein Interaction (1)

Gene RIF (34)

PMID Text
27044892 The F0 domain of K2 binds actin.
26551397 data indicate that kindlin-2 promotes the invasiveness of prostate cancer cells largely through NF-kappaB-dependent upregulation of MMP-9 and MMP-2
26037143 findings suggest that Src, Kindlin-2 and Migfilin together constitute a positive feedback loop that controls Src activity and regulates integrin-mediated cellular func
25618552 our findings suggested that Kindlin-2 was highly expressed in hepatocellular carcinoma tissues and was closely related to clinical progression. Kindlin-2 protein could be a potential biomarker for predicting poor prognosis of HCC patients after surgery.
25605255 High kindlin-2 expression is associated with esophageal squamous cell carcinoma.
25160619 A major ILK binding site in the kindlin-2 FERM domain for regulating cell adhesion has been mapped.
24907935 Data indicate that Kindlin-2 mRNA levels in adult is highly expressed in mesoderm-derived organs.
24599960 the first evidence that interaction between the integrin beta1 cytoplasmic tail and kindlin-2, a member of a family of adapters implicated in human disease pathogenesis, is mainly governed by the beta1 C-terminal carboxylate moiety
23857544 Kindlin-2 might promote the invasion of gastric cancer cells through enhancing proliferation and adhesion by the phosphorylation of integrin beta1 and beta3.
23723426 Kindlin-2 mediates activation of TGF-beta/Smad signaling and renal fibrosis.
23508013 Kindlin-2 was highly expressed in the peritumoral stroma of pancreatic ductal adenocarcinomas. Stromal kindlin-2 expression was related to nodal metastasis (P = 0.03).
23483548 Kindlin 2 plays a novel role in epigenetic repression of miR-200 family, a mechanism that promotes breast cancer invasion.
23337877 A novel regulatory loop has been described between GLI1 and Kindlin-2 that determines cancer cell viability.
23211537 Kindlin-2 regulates breast cancer progression by inducing genome instability.
23209705 Kindlin-1 and Kindlin-2 have opposite roles in lung cancers
23151599 the novel focal adhesion gene kindlin-2 may play an important role in promoting the invasion of gastric cancer cells mediated by tumor-associated macrophages through regulating interleukin expression.
22699938 Kindlin 2 forms a tripartite complex with beta-catenin and TCF4.
22648415 Kindlin-2 and talin head do not interact with one another but can bind simultaneously to the integrin beta(3) tail without enhancing or inhibiting the interaction of the other binding partner.
22391155 Low expression of kindlin-2 correlated with a favorable prognosis for acute myeloid leukemia.
22078565 a membrane-binding function of the ubiquitin-like domain of kindlin-2, which is likely common for all kindlins, promotes localization to the plasma membrane and controls integrin activation
22056622 Kindlin-2 was up-regulated both at RNA (P = .027) and protein levels (P = .014) in gastric cancer tissues and may play an important role in the development and prognosis of gastric cancer.
22030399 Results define a specific PIP3 recognition mode for the kindlin PH domain and shed light upon a mechanism as to how the PH domain mediates membrane engagement of kindlin-2 to promote integrin activation.
21922223 Functional characterization of human Kindlin-2 core promoter identifies a key role of SP1 in Kindlin-2 transcriptional regulation.
21636915 secondary structures predicted from amino-acid sequence alignment of kindlin PH domains indicated that our crystallized kindlin-2 PH domain has an additional C-terminal helix (alpha-2) which is highly conserved in all three kindlin-family proteins
21624607 Kindlin-2 is expressed in a small subset of high-grade invasive bladder cancers and may have a role in tumor progression
21356350 The phenotype of kindlin-1-deficient cells can be modulated by regulating kindlin-2 gene expression and vice versa.
21325030 Kindlin-2 regulates podocyte adhesion and fibronectin deposition through interactions with phosphoinositides and integrinb1 and b3.
20861856 physiological role for kindlin-2 in skin fibroblasts under normal steady-state conditions and during tissue regeneration
20702409 Tyrosine phosphorylation of integrin beta3 regulates kindlin-2 binding and integrin activation.
20127858 our study suggests that heightened expression of Kindlin-2 might contribute to tumor progression in MM.
19854292 cellular functions and possible clinical relevance of kindlin-2 [REVIEW]
18528435 Loss-of-function mutations in KIND1 result in marked variability in kindlin-1 immunolabeling in Kindler syndrome skin, which is mirrored by similar changes in kindlin-2 and migfilin immunoreactivity.
18458155 Results identify kindlin-2 as a novel regulator of integrin beta3 activation; it functions as a coactivator.
14745725 Mig-2 expression is transcriptionally elevated in leiomyomas and could be involved in its hormone-mediated growth of leiomyomas of the uterus.

AA Sequence

MALDGIRMPDGCYADGTWELSVHVTDLNRDVTLRVTGEVHIGGVMLKLVEKLDVKKDWSDHALWWEKKRT      1 - 70
WLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVFKAVSDICKTFNIRHPEELSL     71 - 140
LKKPRDPTKKKKKKLDDQSEDEALELEGPLITPGSGSIYSSPGLYSKTMTPTYDAHDGSPLSPTSAWFGD    141 - 210
SALSEGNPGILAVSQPITSPEILAKMFKPQALLDKAKINQGWLDSSRSLMEQDVKENEALLLRFKYYSFF    211 - 280
DLNPKYDAIRINQLYEQAKWAILLEEIECTEEEMMMFAALQYHINKLSIMTSENHLNNSDKEVDEVDAAL    281 - 350
SDLEITLEGGKTSTILGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESSGTPAHQ    351 - 420
MNLRGCEVTPDVNISGQKFNIKLLIPVAEGMNEIWLRCDNEKQYAHWMAACRLASKGKTMADSSYNLEVQ    421 - 490
NILSFLKMQHLNPDPQLIPEQITTDITPECLVSPRYLKKYKNKQITARILEAHQNVAQMSLIEAKMRFIQ    491 - 560
AWQSLPEFGITHFIARFQGGKKEELIGIAYNRLIRMDASTGDAIKTWRFSNMKQWNVNWEIKMVTVEFAD    561 - 630
EVRLSFICTEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFYKLTSGWV                        631 - 680
//

Text Mined References (59)

PMID Year Title
27044892 2016 Kindlin-2 directly binds actin and regulates integrin outside-in signaling.
26551397 2016 Kindlin-2 promotes invasiveness of prostate cancer cells via NF-?B-dependent upregulation of matrix metalloproteinases.
26037143 2015 Kindlin-2 phosphorylation by Src at Y193 enhances Src activity and is involved in Migfilin recruitment to the focal adhesions.
25646088 2015 Dense fibrillar collagen is a potent inducer of invadopodia via a specific signaling network.
25618552 2015 Kindlin-2: a novel prognostic biomarker for patients with hepatocellular carcinoma.
25605255 2015 A three-protein signature and clinical outcome in esophageal squamous cell carcinoma.
25160619 2014 Molecular basis of kindlin-2 binding to integrin-linked kinase pseudokinase for regulating cell adhesion.
24907935 2014 Kindlin-2 expression in adult tissues correlates with their embryonic origins.
24599960 2014 C-terminal COOH of integrin ?1 is necessary for ?1 association with the kindlin-2 adapter protein.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24162737 2013 Meta-analysis of 74,046 individuals identifies 11 new susceptibility loci for Alzheimer's disease.
23857544 2013 Novel focal adhesion protein kindlin-2 promotes the invasion of gastric cancer cells through phosphorylation of integrin ?1 and ?3.
23723426 2013 Kindlin-2 mediates activation of TGF-?/Smad signaling and renal fibrosis.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23508013 2013 Kindlin-2 expression in peritumoral stroma is associated with poor prognosis in pancreatic ductal adenocarcinoma.
23483548 2013 Kindlin 2 promotes breast cancer invasion via epigenetic silencing of the microRNA200 gene family.
23337877 2013 A feedback regulation between Kindlin-2 and GLI1 in prostate cancer cells.
23211537 2013 Kindlin-2 promotes genome instability in breast cancer cells.
23209705 2012 Opposite role of Kindlin-1 and Kindlin-2 in lung cancers.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23151599 2013 The novel focal adhesion gene kindlin-2 promotes the invasion of gastric cancer cells mediated by tumor-associated macrophages.
22699938 2012 Kindlin 2 forms a transcriptional complex with ?-catenin and TCF4 to enhance Wnt signalling.
22653426 2012 Crystal structure of kindlin-2 PH domain reveals a conformational transition for its membrane anchoring and regulation of integrin activation.
22648415 2012 Spatial coordination of kindlin-2 with talin head domain in interaction with integrin ? cytoplasmic tails.
22391155 2012 [Expression of Kindlins and angiopoietins in acute myeloid leukemia].
22078565 2011 Membrane binding of the N-terminal ubiquitin-like domain of kindlin-2 is crucial for its regulation of integrin activation.
22056622 2012 Kindlin-2: a novel adhesion protein related to tumor invasion, lymph node metastasis, and patient outcome in gastric cancer.
22030399 2011 Structural basis of phosphoinositide binding to kindlin-2 protein pleckstrin homology domain in regulating integrin activation.
21922223 2011 Functional characterization of human Kindlin-2 core promoter identifies a key role of SP1 in Kindlin-2 transcriptional regulation.
21768292 2011 Osteoblast mineralization requires beta1 integrin/ICAP-1-dependent fibronectin deposition.
21636915 2011 Crystallization and preliminary X-ray crystallographic analysis of the human kindlin-2 PH domain.
21624607 2011 Kindlin-2 expression in arsenite- and cadmium-transformed bladder cancer cell lines and in archival specimens of human bladder cancer.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21356350 2011 Kindlin-1 and -2 have overlapping functions in epithelial cells implications for phenotype modification.
21325030 2011 Kindlin-2 regulates podocyte adhesion and fibronectin matrix deposition through interactions with phosphoinositides and integrins.
21269460 2011 Initial characterization of the human central proteome.
20861856 2011 Role of kindlin-2 in fibroblast functions: implications for wound healing.
20702409 2010 Tyrosine phosphorylation of integrin beta3 regulates kindlin-2 binding and integrin activation.
20127858 2010 Kindlin-2 is expressed in malignant mesothelioma and is required for tumor cell adhesion and migration.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19854292 2010 The role of kindlins in cell biology and relevance to human disease.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18528435 2008 Colocalization of kindlin-1, kindlin-2, and migfilin at keratinocyte focal adhesion and relevance to the pathophysiology of Kindler syndrome.
18458155 2008 Kindlin-2 (Mig-2): a co-activator of beta3 integrins.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14745725 2004 Expression of the mitogen-inducible gene-2 (mig-2) is elevated in human uterine leiomyomas but not in leiomyosarcomas.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12789646 2003 Loss of kindlin-1, a human homolog of the Caenorhabditis elegans actin-extracellular-matrix linker protein UNC-112, causes Kindler syndrome.
12697302 2003 URP1: a member of a novel family of PH and FERM domain-containing membrane-associated proteins is significantly over-expressed in lung and colon carcinomas.
12679033 2003 Migfilin and Mig-2 link focal adhesions to filamin and the actin cytoskeleton and function in cell shape modulation.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8175911 1994 Identification of serum-inducible genes: different patterns of gene regulation during G0-->S and G1-->S progression.