Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q96M78
Symbols C8orf78

 Compartment GO Term (0)

AA Sequence

MSQVGRVRSSHHFESVCLDAEVRVVLVALDHAGLHTLSSALNESLRPIHREELHLLHFPNSPEENLRKRP      1 - 70
AEPSPQIHGGAPHLPWLCVEKLDLLPENHAVFLQERTAQLFEGSFFFSRSPAHSISPLLQFRWGHCP        71 - 137
//

Text Mined References (4)

PMID Year Title