Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.23
PubTator Score 0.33

Knowledge Summary


No data available


  Disease (3)


  Differential Expression (2)

Disease log2 FC p
lung adenocarcinoma 1.100 1.0e-02
psoriasis 1.100 7.3e-08

Gene RIF (2)

20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20200978 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

YKKYIIIAFILIILIIFLVLFIYTLPGAISRRIVVGS                                    1821 - 1857

Text Mined References (3)

PMID Year Title
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20200978 2010 Replication of previous genome-wide association studies of bone mineral density in premenopausal American women.
16421571 2006 DNA sequence and analysis of human chromosome 8.