Property Summary

NCBI Gene PubMed Count 68
PubMed Score 53.14
PubTator Score 40.75

Knowledge Summary

Patent (46,693)

TINX Plot

  Disease (5)

Disease Target Count P-value
lung adenocarcinoma 2714 2.8e-19
ovarian cancer 8491 3.0e-14
osteosarcoma 7933 6.5e-04
invasive ductal carcinoma 2950 1.1e-03
diabetes mellitus 1663 2.0e-03
Disease Target Count Z-score Confidence
Disease of metabolism 15 0.0 2.0
Disease Target Count Z-score Confidence
Cancer 2346 3.116 1.6
Disease Target Count Z-score Confidence
Gamma chain deficiency 7 3.357 1.7

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 1.535 6.5e-04
diabetes mellitus -1.200 2.0e-03
lung adenocarcinoma -1.400 2.8e-19
invasive ductal carcinoma -1.400 1.1e-03
ovarian cancer -2.300 3.0e-14

 MGI Phenotype (1)

Protein-protein Interaction (2)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (22)

PMID Text
25867068 Fer serves as a crucial mediator and amplifier of Src-induced tumor progression.
25533491 FER encodes a cytosolic non-receptor tyrosine kinase that influences neutrophil chemotaxis and endothelial permeability.
23931849 Detection of PJA2-FER fusion mRNA is correlated with poor postoperative survival periods in non-small cell lung cancer.
23906537 Fer contributes to aberrant androgen receptor signaling via pSTAT3 cross-talk during castrate-resistant prostate cancer progression.
23873028 FER kinase promotes breast cancer metastasis by regulating alpha6- and beta1-integrin-dependent cell adhesion and anoikis resistance.
23699534 data show that Fer kinase is elevated in non-small cell lung cancer tumors and is important for cellular invasion and metastasis
23445469 Fer expression correlates with renal cell carcinoma cell proliferation both in vitro and in vivo, and with tumor progression and survival
22238358 Fer, a non-receptor-type tyrosine kinase, plays a critical role in synthesis of the laminin-binding glycans on alpha-DG.
22223638 Transcription of the ferT gene in CC cells was found to be driven by an intronic promoter residing in intron 10 of the fer gene and to be regulated by the Brother of the Regulator of Imprinted Sites (BORIS) transcription factor.
21700879 The A allele of SNP rs10447248 in the FER locus was nominally associated with lower MMW (P = 0.016) but was not associated with LMW (P > 0.05) adiponectin levels
21518868 Overexpression of FER from a cDNA confers quinacrine resistance to several different types of cancer cell lines.
21122136 tyrosine phosphorylation of RhoGDIalpha by Fer as a mechanism to regulate binding of RhoGDIalpha to Rac
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19835603 FER plays a role in the invasion and metastasis of hepatocellular carcinoma cells.
19738202 Overexpression of Fer enhanced lamellipodia formation and cell migration in a manner dependent on PLD activity and the PA-FX interaction.
19339212 Results suggest that Fer may allow a bypass of focal adhesion kinase-related cell anchorage dependency for intracellular signal transduction in hepatocytes.
19147545 Fer tyrosine kinase level correlates with the development of prostate cancer and aggressiveness of prostate cancer cell lines
18985748 FerT coexist in the acroplaxome with phosphorylated cortactin, a regulator of F-actin dynamics[Fer testis ]
16732323 Fer is a regulator of cell-cycle progression in malignant cells and a potential target for cancer intervention.
12871378 Fps/Fes and Fer are expressed in human and mouse platelets, and are activated following stimulation with collagen and collagen-related peptide (CRP), suggesting a role in GPVI receptor signaling
11994747 Closing in on the biological functions of Fps/Fes and Fer. A review.

AA Sequence

MGFGSDLKNSHEAVLKLQDWELRLLETVKKFMALRIKSDKEYASTLQNLCNQVDKESTVQMNYVSNVSKS      1 - 70
WLLMIQQTEQLSRIMKTHAEDLNSGPLHRLTMMIKDKQQVKKSYIGVHQQIEAEMIKVTKTELEKLKCSY     71 - 140
RQLIKEMNSAKEKYKEALAKGKETEKAKERYDKATMKLHMLHNQYVLALKGAQLHQNQYYDITLPLLLDS    141 - 210
LQKMQEEMIKALKGIFDEYSQITSLVTEEIVNVHKEIQMSVEQIDPSTEYNNFIDVHRTTAAKEQEIEFD    211 - 280
TSLLEENENLQANEIMWNNLTAESLQVMLKTLAEELMQTQQMLLNKEEAVLELEKRIEESSETCEKKSDI    281 - 350
VLLLSQKQALEELKQSVQQLRCTEAKFSAQKELLEQKVQENDGKEPPPVVNYEEDARSVTSMERKERLSK    351 - 420
FESIRHSIAGIIRSPKSALGSSALSDMISISEKPLAEQDWYHGAIPRIEAQELLKKQGDFLVRESHGKPG    421 - 490
EYVLSVYSDGQRRHFIIQYVDNMYRFEGTGFSNIPQLIDHHYTTKQVITKKSGVVLLNPIPKDKKWILSH    491 - 560
EDVILGELLGKGNFGEVYKGTLKDKTSVAVKTCKEDLPQELKIKFLQEAKILKQYDHPNIVKLIGVCTQR    561 - 630
QPVYIIMELVSGGDFLTFLRRKKDELKLKQLVKFSLDAAAGMLYLESKNCIHRDLAARNCLVGENNVLKI    631 - 700
SDFGMSRQEDGGVYSSSGLKQIPIKWTAPEALNYGRYSSESDVWSFGILLWETFSLGVCPYPGMTNQQAR    701 - 770
EQVERGYRMSAPQHCPEDISKIMMKCWDYKPENRPKFSELQKELTIIKRKLT                      771 - 822
//

Text Mined References (75)

PMID Year Title
25867068 2016 Fer tyrosine kinase oligomer mediates and amplifies Src-induced tumor progression.
25540073 2014 Integrative analysis of high-throughput RNAi screen data identifies the FER and CRKL tyrosine kinases as new regulators of the mitogenic ERK-dependent pathways in transformed cells.
25533491 2015 Genome-wide association study of survival from sepsis due to pneumonia: an observational cohort study.
25391905 2014 Tyrosine phosphorylation of LRP6 by Src and Fer inhibits Wnt/?-catenin signalling.
25381564 2014 Multiple tumor marker protein chip detection system in diagnosis of pancreatic cancer.
25347743 2015 Amplified Ras-MAPK signal states correlate with accelerated EGFR internalization, cytostasis and delayed HER2 tumor onset in Fer-deficient model systems.
25237066 2014 Oncogenic properties of a spermatogenic meiotic variant of fer kinase expressed in somatic cells.
25184253 2014 Phosphoproteomics-mediated identification of Fer kinase as a target of mutant Shp2 in Noonan and LEOPARD syndrome.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24939585 2015 Genome-wide association analysis demonstrates the highly polygenic character of age-related hearing impairment.
23931849 2013 Detection of novel paraja ring finger 2-fer tyrosine kinase mRNA chimeras is associated with poor postoperative prognosis in non-small cell lung cancer.
23906537 2013 The Fer tyrosine kinase acts as a downstream interleukin-6 effector of androgen receptor activation in prostate cancer.
23873028 2013 FER kinase promotes breast cancer metastasis by regulating ?6- and ?1-integrin-dependent cell adhesion and anoikis resistance.
23699534 2013 Fer protein-tyrosine kinase promotes lung adenocarcinoma cell invasion and tumor metastasis.
23589302 2013 The Fer tyrosine kinase is important for platelet-derived growth factor-BB-induced signal transducer and activator of transcription 3 (STAT3) protein phosphorylation, colony formation in soft agar, and tumor growth in vivo.
23573306 2013 FER overexpression is associated with poor postoperative prognosis and cancer-cell survival in non-small cell lung cancer.
23445469 2013 Feline sarcoma-related protein expression correlates with malignant aggressiveness and poor prognosis in renal cell carcinoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22434045 2012 Down-regulation of Fer induces ROS levels accompanied by ATM and p53 activation in colon carcinoma cells.
22238358 2012 Fer kinase regulates cell migration through ?-dystroglycan glycosylation.
22223638 2012 Intronic promoter drives the BORIS-regulated expression of FerT in colon carcinoma cells.
22201778 2012 FES/FER kinase signaling in hematopoietic cells and leukemias.
21700879 2011 Novel locus FER is associated with serum HMW adiponectin levels.
21518868 2011 FER tyrosine kinase (FER) overexpression mediates resistance to quinacrine through EGF-dependent activation of NF-kappaB.
21122136 2010 The Fer tyrosine kinase regulates interactions of Rho GDP-Dissociation Inhibitor ? with the small GTPase Rac.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20111072 2010 FES kinases are required for oncogenic FLT3 signaling.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19835603 2009 Identification of tyrosine-phosphorylated proteins associated with metastasis and functional analysis of FER in human hepatocellular carcinoma cells.
19738202 2009 The tyrosine kinase Fer is a downstream target of the PLD-PA pathway that regulates cell migration.
19379847 Characterization of a de novo balanced translocation in a patient with moderate mental retardation and dysmorphic features.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19339212 2009 Specific tyrosine phosphorylation of focal adhesion kinase mediated by Fer tyrosine kinase in suspended hepatocytes.
19159681 2009 Hsp90 and a tyrosine embedded in the Hsp90 recognition loop are required for the Fer tyrosine kinase activity.
19147545 2009 The Fer tyrosine kinase cooperates with interleukin-6 to activate signal transducer and activator of transcription 3 and promote human prostate cancer cell growth.
18985748 2008 Expression of Fer testis (FerT) tyrosine kinase transcript variants and distribution sites of FerT during the development of the acrosome-acroplaxome-manchette complex in rat spermatids.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17192257 2007 Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry.
16732323 2006 Downregulation of Fer induces PP1 activation and cell-cycle arrest in malignant cells.
16418535 2006 Coordination between the actin cytoskeleton and membrane deformation by a novel membrane tubulation domain of PCH proteins is involved in endocytosis.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15226396 2004 Continuous association of cadherin with beta-catenin requires the non-receptor tyrosine-kinase Fer.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14517306 2003 Tyrosine phosphorylation of plakoglobin causes contrary effects on its association with desmosomes and adherens junction components and modulates beta-catenin-mediated transcription.
12972546 2003 Identification of Fer tyrosine kinase localized on microtubules as a platelet endothelial cell adhesion molecule-1 phosphorylating kinase in vascular endothelial cells.
12871378 2003 Fps/Fes and Fer non-receptor protein-tyrosine kinases regulate collagen- and ADP-induced platelet aggregation.
12738762 2003 Fer is a downstream effector of insulin and mediates the activation of signal transducer and activator of transcription 3 in myogenic cells.
12640114 2003 p120 Catenin-associated Fer and Fyn tyrosine kinases regulate beta-catenin Tyr-142 phosphorylation and beta-catenin-alpha-catenin Interaction.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12118379 2002 Gamma interferon down-regulates Fer and induces its association with inactive Stat3 in colon carcinoma cells.
11994747 2002 Closing in on the biological functions of Fps/Fes and Fer.
11006284 2000 The protein-tyrosine kinase fer associates with signaling complexes containing insulin receptor substrate-1 and phosphatidylinositol 3-kinase.
10998246 2000 N-terminal sequences direct the autophosphorylation states of the FER tyrosine kinases in vivo.
10921917 2000 Cell volume-dependent phosphorylation of proteins of the cortical cytoskeleton and cell-cell contact sites. The role of Fyn and FER kinases.
10878010 2000 FER kinase activation of Stat3 is determined by the N-terminal sequence.
10411641 1999 Tyrosine phosphorylation modulates the interaction of calmodulin with its target proteins.
9748248 1998 The role of tyrosine phosphorylation of cortactin in the locomotion of endothelial cells.
9742951 1998 Tyrosine phosphorylation of the TATA element modulatory factor by the FER nuclear tyrosine kinases.
9742093 1998 Involvement of the tyrosine kinase fer in cell adhesion.
9722593 1998 Growth factor-dependent phosphorylation of the actin-binding protein cortactin is mediated by the cytoplasmic tyrosine kinase FER.
8247543 1993 A survey of protein tyrosine kinase mRNAs expressed in normal human melanocytes.
7623846 1995 The cytoplasmic tyrosine kinase FER is associated with the catenin-like substrate pp120 and is activated by growth factors.
3472906 1987 Polycation-dependent, Ca2+-antagonized phosphorylation of calmodulin by casein kinase-2 and a spleen tyrosine protein kinase.
3350007 1988 Characterization of four tyrosine protein kinases from the particulate fraction of rat spleen.
2725517 1989 Isolation and sequence analysis of a novel human tyrosine kinase gene.
2685575 1989 The FER gene is evolutionarily conserved and encodes a widely expressed member of the FPS/FES protein-tyrosine kinase family.
2209086 1990 The human tyrosine kinase gene (FER) maps to chromosome 5 and is deleted in myeloid leukemias with a del(5q).
2156206 1990 Identification and chromosomal mapping of new human tyrosine kinase genes.
1990274 1991 Nuclear and cytoplasmic location of the FER tyrosine kinase.
1663488 1991 Radiation hybrid map of 13 loci on the long arm of chromosome 5.
1651563 1991 Mutations of chromosome 5q21 genes in FAP and colorectal cancer patients.