Property Summary

NCBI Gene PubMed Count 144
PubMed Score 533.76
PubTator Score 334.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.727 3.8e-03
malignant mesothelioma 1.400 6.6e-07
osteosarcoma -2.401 2.1e-04
group 3 medulloblastoma 2.000 2.9e-04
medulloblastoma, large-cell 1.600 1.1e-06
non-small cell lung cancer 2.198 1.5e-28
intraductal papillary-mucinous carcinoma... 1.500 3.3e-03
intraductal papillary-mucinous neoplasm ... 2.100 1.9e-03
lung cancer 2.400 9.6e-06
colon cancer 1.300 4.6e-05
Breast cancer 2.300 4.0e-02
subependymal giant cell astrocytoma -1.322 1.5e-02
nasopharyngeal carcinoma 1.100 2.8e-05
lung adenocarcinoma 1.007 5.7e-04
psoriasis 1.600 1.2e-11
Endometriosis 1.178 3.2e-02
ductal carcinoma in situ 1.100 2.1e-03
invasive ductal carcinoma 1.700 6.6e-05
ulcerative colitis 1.300 2.0e-05
ovarian cancer 2.500 1.2e-06

Protein-protein Interaction (11)

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
488813 summary 0 / 0 / 0 Probe Development Summary for Inhibitors of Human Flap endonuclease 1 (FEN1)
488816 confirmatory 56 / 27 / 1197 qHTS Validation Assay for the Inhibitors of Human Flap endonuclease 1 (FEN1)
588795 confirmatory 1368 / 7663 / 382244 qHTS Assay for the Inhibitors of Human Flap endonuclease 1 (FEN1).
720498 confirmatory 696 / 186 / 0 qHTS Assay for the Inhibitors of FEN1: Confirmatory Assay for Cherry-picked Compounds

Gene RIF (99)

PMID Text
26884332 Binding of DNA to human FEN1 in a bent conformation occurred independently of 5'-flap accommodation and did not require active site metal ions or the presence of conserved active site residues.
26751069 WDR4 regulates FEN1's potential DNA cleavage threat near the site of replication.
26718738 the aim of the present study was to determine the role of FEN1 in the chemosensitivity of SGC7901 cells.
26708601 The FEN1 rs174538 A allele is a protective biomarker for childhood ALL and this association is more significant in males and in patients at onset age of 3.5 years or older.
26668074 Data indicate that Flap endonuclease 1 (FEN1) single nucleotide polymorphisms and haplotypes are associated with gallbladder cancer risk.
26581212 Under DNA repair conditions, FEN1 efficiently repaired the 5'-phoshotyrosyl bond-containing SSB substrates in the presence of DNA ligase and DNA polymerase.
26431531 Patients with expression of both FEN1 and RAD54B were prone to have advanced nodal involvement and significantly poor prognosis.
26221031 EXO1 and FEN1 cleaved the substrate at the boundary between the single-stranded 5' flap and the duplex, whereas FAN1 incised it three to four nucleotides in the double-stranded region.
26160176 Rate-determining step of FEN1 reflects a kinetic bias against long flaps and trinucleotide repeat sequences.
26032365 In this study, we found that cohesion establishment factors, like CHlR1, cooperatively stimulate endonuclease activity of hFen1 in in vivo mimic condition, including replication protein-A-coated DNA and high salt.
25922071 Because FEN1 mutations have been identified in human cancers, our findings raise the possibility that unresolved RNA:DNA hybrid structures contribute to the genomic instability associated with cancer
25885449 YY1 is a transcription repressor of FEN1 regulating FEN1 levels in response to DNA damaging agents.
25879709 A novel method for monitoring functional lesion-specific recruitment of repair proteins in live cells.
25687118 Fen1 significantly stimulated trinucleotide repeats expansion by Pol beta, but not by the related enzyme Pol lambda.
25154853 FEN1 -69G>A and 4150G>T polymorphisms may be associated with cancer susceptibility in Chinese population.
24880630 FEN1 protein expression was evaluated in 568 oestrogen receptor (ER) negative breast cancers, 894 ER positive breast cancers and 156 ovarian epithelial cancers. FEN1 is a promising biomarker in breast and ovarian epithelial cancer.
24608430 The FEN1 E359K germline mutation disrupts the FEN1-WRN interaction and FEN1 GEN activity, causing aneuploidy-associated cancers.
24440783 FEN1 SNPs and haplotypes were significantly associated with breast cancer risk. The risk alleles showed decreased FEN1 mRNA expression in breast tissues.
24349332 Human Fanconi anemia complementation group a protein stimulates the 5' flap endonuclease activity of FEN1.
24164220 the mutations of the FEN1 gene maybe a rare event in the development of hepatocellular carcinomas in Korean population
24126913 Conserved basic amino acids are not required for double nucleotide unpairing and appear to act cooperatively, whereas the helical cap plays an unexpected role in hFEN1-substrate rearrangement
23975198 The data provides the first observations of unpaired conformations in DNA substrates bound to hFEN1 in the presence of catalytically inert active-site metal ions and define the role of amino acid residues and divalent metal ion cofactors in this process.
23675412 A cryptic targeting signal creates a mitochondrial FEN1 isoform with tailed R-Loop binding properties.
23382697 We identified small-molecule inhibitors of one such target, FEN1, and showed that these compounds were able to selectively kill human cells carrying cancer-relevant mutations.
23184144 This study suggested that FEN1 polymorphisms and haplotypes are associated with glioma risk.
22918592 The homotrimeric proliferating cell nuclear antigen protein (PCNA) coordinates the actions of DNA polymerase, FEN1 and DNA ligase by facilitating the hand-off intermediates between each protein during Okazaki fragment maturation
22787431 These studies demonstrate a novel role for APC in the suppression of Fen1 activity in the BER pathway
22751659 The crystal structure of the complex of importin alpha with a peptide corresponding to the FEN1 nuclear localization sequence was solved.
22749529 Cell-cycle-dependent timing of FEN1 nuclease activity is essential for cell-cycle progression and the maintenance of genome stability.
22586102 Data show models for the ternary PCNA/FEN1/DNA and Rad9-Rad1-Hus1 (9-1-1 complex)/FEN1/DNA assemblies.
22244820 Review: identifies superfamily motifs such as the helical gateway that select for ss-dsDNA junctions and provides key biological insights into FEN1 specificity and regulation.
22072618 FEN1 as an important gene in human gastrointestinal oncogenesis and genetic polymorphisms in FEN1 confer susceptibility to gastrointestinal cancers.
22011247 Data show that among the 13 SNPs in the 3 genes, only 3 were found to be polymorphic: R196K and K277R in the DFFB gene, and S12L in the EndoG gene, and all 6 SNPs in the FEN-1 gene were entirely monoallelic.
21496641 Structural and functional analyses of human FEN1:DNA complexes show structure-specific, sequence-independent recognition for nicked dsDNA bent 100 degrees with unpaired 3' and 5' flaps.
21454907 Activity of FEN1 endonuclease on nucleosome substrates is dependent upon DNA sequence but not flap orientation.
21345332 these results show that FEN1 and telomerase association occurs throughout the S phase, with the maximum association in the mid S phase.
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20802161 FEN1 10154T variant allele decreases arachidonic acid and arachidonic acid/linoleic acid in the serum phospholipids of carriers of the APOA5-1131C allele
20802161 Observational study of gene-disease association. (HuGE Navigator)
20729856 the methylated form, but not the phosphorylated form, of FEN1 strongly interacts with proliferating cell nuclear antigen (PCNA), ensuring the 'on' and 'off' timing of its reaction
20643645 FEN1 and EXO1 can eliminate structures formed by trinucleotide repeats in the course of replication, relying on endonucleolytic and exonucleolytic activities, respectively.
20574454 Observational study of gene-disease association. (HuGE Navigator)
20551483 FEN1 maintains stable telomeres by facilitating replication through the G-rich lagging strand telomere, thereby ensuring high fidelity telomere replication.
20522537 Observational study of gene-disease association. (HuGE Navigator)
20496165 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20444887 Herpes simplex virus 1 DNA polymerase stimulated the nick translation activity of human Fen-1 on DNA- or RNA-containing primer/templates, indicating that the activities were coordinated.
20226869 Observational study of gene-disease association. (HuGE Navigator)
20126648 results suggest that EXO1 may act at transcription-induced telomeric structures to promote telomere recombination while FEN1 has a dominant role in lagging strand replication at telomeres
20019387 Acetylation of Dna2 endonuclease/helicase and flap endonuclease 1 by p300 promotes DNA stability by creating long flap intermediates.
19674974 Data show that disruption of DNA polymerase beta and FEN1 coordination during long-patch base excision repair results in CAG repeat expansion.
19618370 These results highlight FEN1 as an important gene in human carcinogenesis and genetic polymorphisms in FEN1 confer susceptibility to lung cancer.
19618370 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19525235 the presence of a 3'-flap is the critical feature for efficient hFEN1 substrate recognition and catalysis
19329428 Abasic sites can also affect the strand displacement activity of the lagging strand DNA pol delta that can be overcome through a polymerase switch, involving the combined physical and functional interaction of DNA pol beta and Flap endonuclease 1.
19218431 RAD54B-deficient human colorectal cancer cells are sensitive to synthetic lethal killing by reduced FEN1 expression, while isogenic RAD54B proficient cells are not
19208620 Data show that replication factor C (RFC), via several stimulatory motifs per molecule, potently activates flap endonuclease 1 (FEN1), making RFC a critical partner with FEN1 for the processing of eukaryotic Okazaki fragments.
19068479 FEN1 and telomerase physically co-exist as a complex and that FEN1 can regulate telomerase activity at telomeres in mammalian cells.
19010819 findings show that FEN1 is significantly up-regulated in multiple cancers and the aberrant expression of FEN1 is associated with hypomethylation of the CpG island within the FEN1 promoter in tumor cells
18786645 DENSPM treatment affects the cellular distribution of FEN1 in L56Br-C1 cells, but not in MCF-7 cells, implying that FEN1 is affected by or involved in DENSPM-induced apoptosis.
18669164 Observational study of gene-disease association. (HuGE Navigator)
18662981 NEIL1 could also participate in strand displacement repair synthesis (long patch repair (LP-BER)) mediated by FEN-1 and stimulated by PCNA.
18541666 Repair of 2-deoxyribonolactone is via long-patch BER (LP-BER) dependent on flap endonuclease 1 (FEN1) in mitochondria.
18499658 hChlR1 has a role in the establishment of sister chromatid cohesion, with Ctf18-RFC and Fen1
18443037 The replacement of Ser(187) by Ala, eliminating the only phosphorylation site, retains FEN1 in nucleoli.
18417526 Observational study of gene-disease association. (HuGE Navigator)
18394896 contributes to telomere stability by ensuring efficient telomere replication
18291413 C-terminus of FEN-1 is important for protein binding
18097100 Asymmetric unit is predicted to contain two complexes in the crystallographic asymmetric unit. A diffraction data set was collected to a resolution of 2.75 A.
17488975 endogenously expressed FEN-1 associates with the native pS2 gene in MCF-7 cells and influences estrogen-responsive gene expression
17176113 Both pol-beta and Fen-1 interact with a 138-amino-acid peptide from adenomatosis polyposis coli protein at the DNA repair inhibitory (DRI) domain.
16914748 The rearrangement frequency was found to increase with array size, and partial complementation of the rad27Delta mutation by hFEN1 demonstrated that the production of novel CEB1 alleles is Rad52 and Rad51 dependent.
16582103 A general DNA substrate-binding model that helps explains how the single active center of FEN-1 can perform cleavage on various substrates.
15758026 Fen1 exchange depends on the rate of movement of replication forks.
15616578 The structural basis of the FEN1-PCNA interaction was revealed by the crystal structure of the complex between human FEN1 and proliferating cell nuclear antigen
15592449 a novel gap endonuclease (GEN) activity of human flap endonuclease 1 (FEN-1), critical in resolving stalled replication fork
15579905 results suggest that BLM suppresses genome instability by aiding FEN1 cleavage of structure-containing flaps
15561706 pol beta cooperates with FEN1 to remove DNA damage via a "Hit and Run" mechanism, involving alternating short gap production by FEN1 and gap filling by pol beta
15556996 identification of rad9-rad1-hus1 as a damage-specific activator of flap endonuclease 1
15131255 substrate specificity of Fen1 has been functionally conserved over a billion years from archaea to human
15037610 model for human FEN-1 protein interaction with its DNA substrates
14688284 flap endonuclease-1 is stimulated by the Bloom's syndrome protein
14657243 WRN and FEN-1 proteins function together to process DNA structures associated with the replication fork.
14562054 Alterations of FEN1 are not likely to contribute to development of lung cancer.
12917330 We report here that faulty processing by FEN-1 initiates repeat instability in mammalian cells
12856420 action at DNA replication forks
12853968 Phosphorylation of human Fen1 by cyclin-dependent kinase modulates its role in replication fork regulation.
12683998 C-terminal lysines are important for the endonuclease and exonuclease activities likely through DNA binding
12554738 human flap endonuclease 1 mutants employ endonuclease rather than exonuclease to prevent triplet repeat expansion
12515398 This protein can procss the 5'-flap DNA of CTG/CAG triplet repeat derived from human genetic diseases.
12494477 Single nucleotide polymorphism in exon 15 of the XPG gene exhibited marginally significant increased frequency of the variant allele compared to controls.
12411510 flexible loop is important for efficient cleavage through positioning the 5' flap and the catalytic site
12356323 interaction of the WRN gene product with human 5' flap endonuclease/5'-3' exonuclease (FEN-1)
12200445 stimulated by APE1 for progression through the base excision repair pathway
12065902 the rate of excision by FEN-1 of 5'-flaps from short- and long-flap oligonucleotide substrates that mimic pre- and post-repair HIV-1 integration intermediates, respectively, and the effect of HIV-1 integrase on these reactions were examined
12065902 FEN-1 is stimulated by HIV-1 Integrase and is hypothesized to play a role in the processing of HIV-1 integration intermediates
11986308 Arginine residues 47 and 70 are involved in DNA substrate interactions and cleavage site determination
11948189 DNA ligase I competes with FEN1 to expand repetitive DNA sequences in vitro.
11601988 Direct physical interaction between FEN1 and AP endonuclease 1 during long-patch base excision repair provides coordinated loading of the proteins onto the substrate, thus passing the substrate from one enzyme to another.
11260214 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGIQGLAKLIADVAPSAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGGDVLQNEEGETTSHLMGMFYR      1 - 70
TIRMMENGIKPVYVFDGKPPQLKSGELAKRSERRAEAEKQLQQAQAAGAEQEVEKFTKRLVKVTKQHNDE     71 - 140
CKHLLSLMGIPYLDAPSEAEASCAALVKAGKVYAAATEDMDCLTFGSPVLMRHLTASEAKKLPIQEFHLS    141 - 210
RILQELGLNQEQFVDLCILLGSDYCESIRGIGPKRAVDLIQKHKSIEEIVRRLDPNKYPVPENWLHKEAH    211 - 280
QLFLEPEVLDPESVELKWSEPNEEELIKFMCGEKQFSEERIRSGVKRLSKSRQGSTQGRLDDFFKVTGSL    281 - 350
SSAKRKEPEPKGSTKKKAKTGAAGKFKRGK                                            351 - 380
//

Text Mined References (152)

PMID Year Title
26884332 2016 DNA and Protein Requirements for Substrate Conformational Changes Necessary for Human Flap Endonuclease-1-catalyzed Reaction.
26751069 2016 Wuho Is a New Member in Maintaining Genome Stability through its Interaction with Flap Endonuclease 1.
26718738 2016 Flap endonuclease 1 silencing is associated with increasing the cisplatin sensitivity of SGC?7901 gastric cancer cells.
26708601 The Association of Flap Endonuclease 1 Genotypes with the Risk of Childhood Leukemia.
26668074 2015 Variants and haplotypes in Flap endonuclease 1 and risk of gallbladder cancer and gallstones: a population-based study in China.
26581212 2016 FEN1 participates in repair of the 5'-phosphotyrosyl terminus of DNA single-strand breaks.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26431531 2015 The Overexpression of FEN1 and RAD54B May Act as Independent Prognostic Factors of Lung Adenocarcinoma.
26221031 2015 FANCD2-associated nuclease 1, but not exonuclease 1 or flap endonuclease 1, is able to unhook DNA interstrand cross-links in vitro.
26160176 2015 Rate-determining Step of Flap Endonuclease 1 (FEN1) Reflects a Kinetic Bias against Long Flaps and Trinucleotide Repeat Sequences.
26032365 2015 Cohesion Establishment Factors Stimulate Endonuclease Activity of hFen1 Independently and Cooperatively.
25922071 2015 Flap Endonuclease 1 Limits Telomere Fragility on the Leading Strand.
25885449 2015 YY1 suppresses FEN1 over-expression and drug resistance in breast cancer.
25879709 2015 A novel method for monitoring functional lesion-specific recruitment of repair proteins in live cells.
25687118 2015 Expansion of CAG triplet repeats by human DNA polymerases ? and ? in vitro, is regulated by flap endonuclease 1 and DNA ligase 1.
25378300 2014 Opposing roles of mitochondrial and nuclear PARP1 in the regulation of mitochondrial and nuclear DNA integrity: implications for the regulation of mitochondrial function.
25194280 2014 Genome-wide association study identifies three susceptibility loci for laryngeal squamous cell carcinoma in the Chinese population.
25154853 2014 FEN1 -69G>A and 4150G>T polymorphisms and cancer risk in Chinese population.
24880630 2014 Genomic and protein expression analysis reveals flap endonuclease 1 (FEN1) as a key biomarker in breast and ovarian cancer.
24836286 2014 Large-scale genetic study in East Asians identifies six new loci associated with colorectal cancer risk.
24823311 2014 Genome-wide association study of plasma N6 polyunsaturated fatty acids within the cohorts for heart and aging research in genomic epidemiology consortium.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24608430 2015 The FEN1 E359K germline mutation disrupts the FEN1-WRN interaction and FEN1 GEN activity, causing aneuploidy-associated cancers.
24440783 2014 Association of functional FEN1 genetic variants and haplotypes and breast cancer risk.
24349332 2013 Human Fanconi anemia complementation group a protein stimulates the 5' flap endonuclease activity of FEN1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24270157 2013 A quantitative telomeric chromatin isolation protocol identifies different telomeric states.
24164220 2014 Mutational analysis of FEN1 gene in hepatocellular carcinomas.
24126913 2013 Proline scanning mutagenesis reveals a role for the flap endonuclease-1 helical cap in substrate unpairing.
23975198 2013 Observation of unpaired substrate DNA in the flap endonuclease-1 active site.
23675412 2013 A cryptic targeting signal creates a mitochondrial FEN1 isoform with tailed R-Loop binding properties.
23382697 2013 An evolutionarily conserved synthetic lethal interaction network identifies FEN1 as a broad-spectrum target for anticancer therapeutic development.
23378610 2013 Genetic variants associated with glycine metabolism and their role in insulin sensitivity and type 2 diabetes.
23362303 2013 Genome-wide association study identifies novel loci associated with concentrations of four plasma phospholipid fatty acids in the de novo lipogenesis pathway: results from the Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) consortium.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23184144 2013 Functional FEN1 genetic variants and haplotypes are associated with glioma risk.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22918592 2012 The wonders of flap endonucleases: structure, function, mechanism and regulation.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22787431 2012 Adenomatous polyposis coli interacts with flap endonuclease 1 to block its nuclear entry and function.
22751659 2012 Structural basis of nuclear import of flap endonuclease 1 (FEN1).
22749529 2012 Sequential posttranslational modifications program FEN1 degradation during cell-cycle progression.
22586102 2012 Repair complexes of FEN1 endonuclease, DNA, and Rad9-Hus1-Rad1 are distinguished from their PCNA counterparts by functionally important stability.
22551069 2012 Human MUS81 complexes stimulate flap endonuclease 1.
22244820 2012 Double strand binding-single strand incision mechanism for human flap endonuclease: implications for the superfamily.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
22072618 2012 Functional FEN1 genetic variants contribute to risk of hepatocellular carcinoma, esophageal cancer, gastric cancer and colorectal cancer.
22011247 2012 Nonsynonymous single-nucleotide polymorphisms of the human apoptosis-related endonuclease--DNA fragmentation factor beta polypeptide, endonuclease G, and Flap endonuclease-1--genes show a low degree of genetic heterogeneity.
21829377 2011 Genetic loci associated with plasma phospholipid n-3 fatty acids: a meta-analysis of genome-wide association studies from the CHARGE Consortium.
21496641 2011 Human flap endonuclease structures, DNA double-base flipping, and a unified understanding of the FEN1 superfamily.
21454907 2011 Activity of FEN1 endonuclease on nucleosome substrates is dependent upon DNA sequence but not flap orientation.
21345332 2011 Mapping the FEN1 interaction domain with hTERT.
21269460 2011 Initial characterization of the human central proteome.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20802161 2010 Interactions between the APOA5 -1131T>C and the FEN1 10154G>T polymorphisms on ?6 polyunsaturated fatty acids in serum phospholipids and coronary artery disease.
20729856 2010 Methylation of FEN1 suppresses nearby phosphorylation and facilitates PCNA binding.
20643645 2010 Complementary roles for exonuclease 1 and Flap endonuclease 1 in maintenance of triplet repeats.
20574454 2010 Polymorphisms in the base excision repair pathway and graft-versus-host disease.
20551483 2010 FEN1 ensures telomere stability by facilitating replication fork re-initiation.
20522537 2010 Variation within DNA repair pathway genes and risk of multiple sclerosis.
20496165 2011 Comprehensive screen of genetic variation in DNA repair pathway genes and postmenopausal breast cancer risk.
20444887 2010 Processing of lagging-strand intermediates in vitro by herpes simplex virus type 1 DNA polymerase.
20226869 2010 Association between genetic variants in the base excision repair pathway and outcomes after hematopoietic cell transplantations.
20126648 2010 Distinct activities of exonuclease 1 and flap endonuclease 1 at telomeric g4 DNA.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20019387 2010 Acetylation of Dna2 endonuclease/helicase and flap endonuclease 1 by p300 promotes DNA stability by creating long flap intermediates.
19946888 2010 Defining the membrane proteome of NK cells.
19674974 2009 Coordination between polymerase beta and FEN1 can modulate CAG repeat expansion.
19618370 2009 Functional FEN1 polymorphisms are associated with DNA damage levels and lung cancer risk.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19525235 2009 The 3'-flap pocket of human flap endonuclease 1 is critical for substrate binding and catalysis.
19329428 2009 The block of DNA polymerase delta strand displacement activity by an abasic site can be rescued by the concerted action of DNA polymerase beta and Flap endonuclease 1.
19218431 2009 Specific synthetic lethal killing of RAD54B-deficient human colorectal cancer cells by FEN1 silencing.
19208620 2009 Human replication factor C stimulates flap endonuclease 1.
19135898 2009 Purification of proteins associated with specific genomic Loci.
19068479 2009 Human flap endonuclease I is in complex with telomerase and is required for telomerase-mediated telomere maintenance.
19010819 2008 Overexpression and hypomethylation of flap endonuclease 1 gene in breast and other cancers.
18995831 2008 Human DNA2 is a mitochondrial nuclease/helicase for efficient processing of DNA replication and repair intermediates.
18786645 2008 Effect of polyamine deficiency on proteins involved in Okazaki fragment maturation.
18692475 2008 A protein domain-based interactome network for C. elegans early embryogenesis.
18669164 2008 Association of polymorphisms in base excision repair genes with the risk of breast cancer: a case-control study in North Indian women.
18662981 2008 Physical and functional interaction between human oxidized base-specific DNA glycosylase NEIL1 and flap endonuclease 1.
18541666 2008 Removal of oxidative DNA damage via FEN1-dependent long-patch base excision repair in human cell mitochondria.
18499658 2008 Studies with the human cohesin establishment factor, ChlR1. Association of ChlR1 with Ctf18-RFC and Fen1.
18443037 2008 Nucleolar localization and dynamic roles of flap endonuclease 1 in ribosomal DNA replication and damage repair.
18417526 2008 Associations of DNase IV polymorphisms with autoantibodies in patients with systemic lupus erythematosus.
18394896 2008 Flap endonuclease 1 contributes to telomere stability.
18291413 2008 Comprehensive mapping of the C-terminus of flap endonuclease-1 reveals distinct interaction sites for five proteins that represent different DNA replication and repair pathways.
18097100 2008 Crystallization and preliminary crystallographic analysis of the catalytic domain of human flap endonuclease 1 in complex with a nicked DNA product: use of a DPCS kit for efficient protein-DNA complex crystallization.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17488975 2007 The deoxyribonucleic acid repair protein flap endonuclease-1 modulates estrogen-responsive gene expression.
17176113 2006 Mechanism of adenomatous polyposis coli (APC)-mediated blockage of long-patch base excision repair.
16914748 2006 Complex minisatellite rearrangements generated in the total or partial absence of Rad27/hFEN1 activity occur in a single generation and are Rad51 and Rad52 dependent.
16582103 2006 The DNA-protein interaction modes of FEN-1 with gap substrates and their implication in preventing duplication mutations.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16216273 2005 The two DNA clamps Rad9/Rad1/Hus1 complex and proliferating cell nuclear antigen differentially regulate flap endonuclease 1 activity.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15758026 2005 High mobility of flap endonuclease 1 and DNA polymerase eta associated with replication foci in mammalian S-phase nucleus.
15635413 2005 Nucleolar proteome dynamics.
15616578 2005 Structural basis for recruitment of human flap endonuclease 1 to PCNA.
15592449 2005 Novel function of the flap endonuclease 1 complex in processing stalled DNA replication forks.
15579905 2005 Human Bloom protein stimulates flap endonuclease 1 activity by resolving DNA secondary structure.
15576034 2004 Structural and thermodynamic analysis of human PCNA with peptides derived from DNA polymerase-delta p66 subunit and flap endonuclease-1.
15561706 2005 DNA polymerase beta and flap endonuclease 1 enzymatic specificities sustain DNA synthesis for long patch base excision repair.
15556996 2004 The human Rad9-Rad1-Hus1 checkpoint complex stimulates flap endonuclease 1.
15504738 2005 Genes affecting the cell cycle, growth, maintenance, and drug sensitivity are preferentially regulated by anti-HER2 antibody through phosphatidylinositol 3-kinase-AKT signaling.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15131255 2004 The Fen1 extrahelical 3'-flap pocket is conserved from archaea to human and regulates DNA substrate specificity.
15037610 2004 Interaction interface of human flap endonuclease-1 with its DNA substrates.
14690413 2003 Interaction and stimulation of human FEN-1 nuclease activities by heterogeneous nuclear ribonucleoprotein A1 in alpha-segment processing during Okazaki fragment maturation.
14688284 2004 Stimulation of flap endonuclease-1 by the Bloom's syndrome protein.
14657243 2004 WRN helicase and FEN-1 form a complex upon replication arrest and together process branchmigrating DNA structures associated with the replication fork.
14562054 2003 Increased expression and no mutation of the Flap endonuclease (FEN1) gene in human lung cancer.
12917330 2003 Nuclease-deficient FEN-1 blocks Rad51/BRCA1-mediated repair and causes trinucleotide repeat instability.
12856420 Early immobilization of nuclease FEN1 and accumulation of hRAD18 protein at stalled DNA replication forks in mammalian cells.
12853968 2003 Phosphorylation of human Fen1 by cyclin-dependent kinase modulates its role in replication fork regulation.
12683998 2003 The acetylatable lysines of human Fen1 are important for endo- and exonuclease activities.
12554738 2003 Analysis of human flap endonuclease 1 mutants reveals a mechanism to prevent triplet repeat expansion.
12515398 2002 Human FEN-1 can process the 5'-flap DNA of CTG/CAG triplet repeat derived from human genetic diseases by length and sequence dependent manner.
12494477 2003 Single nucleotide polymorphisms in the XPG gene: determination of role in DNA repair and breast cancer risk.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12453426 2002 Flap endonuclease 1 efficiently cleaves base excision repair and DNA replication intermediates assembled into nucleosomes.
12427278 2002 Two overlapping divergent transcription units in the human genome: the FEN1/C11orf10 locus.
12411510 2002 The flexible loop of human FEN1 endonuclease is required for flap cleavage during DNA replication and repair.
12356323 2002 Biochemical characterization of the WRN-FEN-1 functional interaction.
12200445 2002 AP endonuclease 1 coordinates flap endonuclease 1 and DNA ligase I activity in long patch base excision repair.
12065902 Stimulation of human flap endonuclease 1 by human immunodeficiency virus type 1 integrase: possible role for flap endonuclease 1 in 5'-end processing of human immunodeficiency virus type 1 integration intermediates.
11986308 2002 Arginine residues 47 and 70 of human flap endonuclease-1 are involved in DNA substrate interactions and cleavage site determination.
11948189 2002 DNA ligase I competes with FEN1 to expand repetitive DNA sequences in vitro.
11601988 2001 Interaction of human AP endonuclease 1 with flap endonuclease 1 and proliferating cell nuclear antigen involved in long-patch base excision repair.
11598021 2001 Werner syndrome protein interacts with human flap endonuclease 1 and stimulates its cleavage activity.
11430825 2001 Regulation of human flap endonuclease-1 activity by acetylation through the transcriptional coactivator p300.
11260214 2001 The "flap" endonuclease gene FEN1 is excluded as a candidate gene implicated in the CAG repeat expansion underlying Huntington disease.
10744741 2000 Mechanism whereby proliferating cell nuclear antigen stimulates flap endonuclease 1.
10635332 1999 Inhibition of FEN-1 processing by DNA secondary structure at trinucleotide repeats.
10559261 1999 Reconstitution of proliferating cell nuclear antigen-dependent repair of apurinic/apyrimidinic sites with purified human proteins.
10545607 1999 Functional analysis of human FEN1 in Saccharomyces cerevisiae and its role in genome stability.
10460157 1999 Replication protein A stimulates proliferating cell nuclear antigen-dependent repair of abasic sites in DNA by human cell extracts.
9545252 1998 Regulation of DNA replication and repair proteins through interaction with the front side of proliferating cell nuclear antigen.
9445487 1998 A gene map of the Best's vitelliform macular dystrophy region in chromosome 11q12-q13.1.
9305916 1997 The DNA repair endonuclease XPG binds to proliferating cell nuclear antigen (PCNA) and shares sequence elements with the PCNA-binding regions of FEN-1 and cyclin-dependent kinase inhibitor p21.
9214649 1997 Second pathway for completion of human DNA base excision-repair: reconstitution with purified proteins and requirement for DNase IV (FEN1).
8876181 1996 p21Cip1/Waf1 disrupts the recruitment of human Fen1 by proliferating-cell nuclear antigen into the DNA replication complex.
8621570 1996 Essential amino acids for substrate binding and catalysis of human flap endonuclease 1.
8131753 1994 The characterization of a mammalian DNA structure-specific endonuclease.
8007985 1994 Structural and functional conservation of the human homolog of the Schizosaccharomyces pombe rad2 gene, which is required for chromosome segregation and recovery from DNA damage.
7961795 1994 Structural and functional homology between mammalian DNase IV and the 5'-nuclease domain of Escherichia coli DNA polymerase I.
7774922 1995 Sequence of human FEN-1, a structure-specific endonuclease, and chromosomal localization of the gene (FEN1) in mouse and human.
7673186 1995 Lagging strand DNA synthesis at the eukaryotic replication fork involves binding and stimulation of FEN-1 by proliferating cell nuclear antigen.
1477073 1992 Improving responses in hepatomas with circadian-patterned hepatic artery infusions of recombinant interleukin-2.